ANKS6 ANKS6
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 20
Residues 22–67 · 45 aa
(5.2% of protein) · Min inter-cluster distance: 5.915
A blocks
Sequence
ETARRLLEPGAAEPAERGAEPEAGAEPAGAEVAGPGAAAAGAVGA
Top exceptional features (|z-score| rank)
A Patch: +8.62Frac A: +5.10Frac Aliphatic: +3.89E/D Ratio: +2.36pro-pro: -2.02Hydrophobicity: +1.97Disorder Promoting: +1.96Frac S: -1.87
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.000 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.864 |
| neg-aro | +0.000 |
| neg-ala | -0.239 |
| neg-pro | -1.746 |
| neg-gly | -0.685 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -0.423 |
| ala-pro | -0.571 |
| ala-gly | -1.799 |
| pro-pro | -2.021 |
| pro-gly | -1.519 |
| gly-gly | -1.866 |
| Frac A | +5.103 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | +1.318 |
| Frac F | -0.807 |
| Frac G | +1.527 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | -0.408 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.028 |
| Frac Q | -1.207 |
| Frac R | +0.018 |
| Frac S | -1.874 |
| Frac T | -0.785 |
| Frac V | +0.313 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.795 |
| Frac D+E | +0.419 |
| Frac Polar | -1.797 |
| Frac Aliphatic | +3.890 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +1.328 |
| E/D Ratio | +2.361 |
| Frac Chain Expanding | -0.259 |
| FCR | -0.205 |
| NCPR | -0.840 |
| Hydrophobicity | +1.967 |
| Disorder Promoting | +1.962 |
| Iso point | -1.112 |
| PPII | -0.074 |
| A Patch | +8.623 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 24
Residues 476–539 · 63 aa
(7.2% of protein) · Min inter-cluster distance: 3.279
Weak negative charge
Sequence
RGLSSNQPLPFSDEPEPALDSTMRAAPQDKTSRSALPDAAPVTKDNGPGSTRGEKEDTLLTTM
Top exceptional features (|z-score| rank)
Frac T: +1.21pol-neg: +1.06Frac D: +1.06Frac L: +1.05E/D Ratio: -1.01Iso point: -0.94Frac I: -0.90Frac H: -0.85
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.189 |
| pol-hyd | -0.714 |
| pol-pos | -0.538 |
| pol-neg | +1.058 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.500 |
| pol-gly | +0.000 |
| hyd-hyd | -0.497 |
| hyd-pos | +0.116 |
| hyd-neg | +0.586 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.389 |
| hyd-gly | +0.000 |
| pos-pos | -0.391 |
| pos-neg | -0.147 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.655 |
| pos-gly | +0.000 |
| neg-neg | +0.080 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.406 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.451 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.327 |
| Frac C | -0.582 |
| Frac D | +1.058 |
| Frac E | -0.400 |
| Frac F | +0.091 |
| Frac G | -0.321 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.237 |
| Frac L | +1.047 |
| Frac M | +0.802 |
| Frac N | +0.029 |
| Frac P | +0.197 |
| Frac Q | -0.504 |
| Frac R | -0.045 |
| Frac S | -0.209 |
| Frac T | +1.209 |
| Frac V | -0.731 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.207 |
| Frac D+E | +0.200 |
| Frac Polar | -0.329 |
| Frac Aliphatic | +0.524 |
| Frac Aromatic | -0.531 |
| R/K Ratio | +0.102 |
| E/D Ratio | -1.013 |
| Frac Chain Expanding | +0.158 |
| FCR | +0.015 |
| NCPR | -0.287 |
| Hydrophobicity | +0.327 |
| Disorder Promoting | +0.137 |
| Iso point | -0.944 |
| PPII | +0.058 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 6
Residues 562–781 · 219 aa
(25.1% of protein) · Min inter-cluster distance: 1.068
S patches
Sequence
PPSSFELWSSDRSRTRHNGKADPMKTALPQRASRGHPVGGGGTDTTPVRPVKFPSLPRSPASSANSGNFNHSPHSSGGSSGVGVSRHGGELLNRSGGSIDNVLSQIAAQRKKAAGLLEQKPSHRSSPVGPAPGSSPSELPASPAGGSAPVGKKLETSKRPPSGTSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGI
Top exceptional features (|z-score| rank)
pos-gly: +2.41pol-hyd: +2.06S Patch: +1.84gly-gly: +1.69pro-gly: +1.50Frac S: +1.48pro-pro: +1.29Frac Polar: +1.22
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.120 |
| pol-hyd | +2.065 |
| pol-pos | +0.593 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.158 |
| pol-gly | +1.184 |
| hyd-hyd | -0.119 |
| hyd-pos | +0.559 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.315 |
| hyd-gly | +0.355 |
| pos-pos | +0.838 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.134 |
| pos-gly | +2.409 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.293 |
| pro-gly | +1.503 |
| gly-gly | +1.693 |
| Frac A | -0.247 |
| Frac C | -0.582 |
| Frac D | -0.575 |
| Frac E | -0.805 |
| Frac F | -0.032 |
| Frac G | +0.646 |
| Frac H | +0.487 |
| Frac I | +0.021 |
| Frac K | -0.110 |
| Frac L | -0.111 |
| Frac M | -0.597 |
| Frac N | -0.110 |
| Frac P | +0.015 |
| Frac Q | -0.702 |
| Frac R | -0.127 |
| Frac S | +1.479 |
| Frac T | +0.355 |
| Frac V | +0.191 |
| Frac W | -0.092 |
| Frac Y | -0.609 |
| Frac K+R | -0.167 |
| Frac D+E | -0.891 |
| Frac Polar | +1.221 |
| Frac Aliphatic | -0.381 |
| Frac Aromatic | -0.442 |
| R/K Ratio | -0.055 |
| E/D Ratio | -0.230 |
| Frac Chain Expanding | -0.900 |
| FCR | -0.780 |
| NCPR | +0.564 |
| Hydrophobicity | +0.549 |
| Disorder Promoting | +0.606 |
| Iso point | +1.074 |
| PPII | -0.591 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +0.297 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.841 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |