ANLN ANLN
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 9
Residues 0–199 · 199 aa
(17.7% of protein) · Min inter-cluster distance: 0.8
Blocks of positive & negative residues
Sequence
MDPFTEKLLERTRARRENLQRKMAERPTAAPRSMTHAKRARQPLSEASNQQPLSGGEEKSCTKPSPSKKRCSDNTEVEVSNLENKQPVESTSAKSCSPSPVSPQVQPQAADTISDSVAVPASLLGMRRGLNSRLEATAASSVKTRMQKLAEQRRRWDNDDMTDDIPESSLFSPMPSEEKAASPPRPLLSNASATPVGRR
Top exceptional features (|z-score| rank)
ala-ala: +1.90neg-pro: +1.76pol-pol: -1.68pos-pos: +1.58pos-pro: +1.51neg-ala: +1.50pos-neg: +1.21D Patch: +1.09
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.678 |
| pol-hyd | -1.082 |
| pol-pos | +0.259 |
| pol-neg | -0.429 |
| pol-aro | +0.000 |
| pol-ala | -0.788 |
| pol-pro | -0.996 |
| pol-gly | +0.000 |
| hyd-hyd | -0.950 |
| hyd-pos | +0.482 |
| hyd-neg | -1.010 |
| hyd-aro | +0.000 |
| hyd-ala | +0.708 |
| hyd-pro | -0.847 |
| hyd-gly | +0.000 |
| pos-pos | +1.578 |
| pos-neg | +1.211 |
| pos-aro | +0.000 |
| pos-ala | +0.533 |
| pos-pro | +1.514 |
| pos-gly | +0.000 |
| neg-neg | +0.770 |
| neg-aro | +0.000 |
| neg-ala | +1.496 |
| neg-pro | +1.762 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +1.900 |
| ala-pro | +0.749 |
| ala-gly | +0.000 |
| pro-pro | +0.583 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.424 |
| Frac C | +0.446 |
| Frac D | -0.146 |
| Frac E | -0.146 |
| Frac F | -0.239 |
| Frac G | -0.941 |
| Frac H | -0.666 |
| Frac I | -0.394 |
| Frac K | -0.012 |
| Frac L | +0.334 |
| Frac M | +0.978 |
| Frac N | +0.300 |
| Frac P | -0.178 |
| Frac Q | -0.094 |
| Frac R | +0.689 |
| Frac S | +0.235 |
| Frac T | +0.069 |
| Frac V | +0.341 |
| Frac W | -0.051 |
| Frac Y | -0.609 |
| Frac K+R | +0.450 |
| Frac D+E | -0.181 |
| Frac Polar | -0.452 |
| Frac Aliphatic | +0.902 |
| Frac Aromatic | -0.561 |
| R/K Ratio | +0.372 |
| E/D Ratio | +0.142 |
| Frac Chain Expanding | +0.058 |
| FCR | +0.159 |
| NCPR | +0.433 |
| Hydrophobicity | +0.252 |
| Disorder Promoting | -0.594 |
| Iso point | +0.670 |
| PPII | +0.107 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +1.086 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +0.458 |
| S Patch | +0.257 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 17
Residues 286–404 · 118 aa
(10.5% of protein) · Min inter-cluster distance: 16.177
Weak positive charge
Sequence
ISSSVKATSPVKSTTSITDAKSCEGQNPELLPKTPISPLKTGVSKPIVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNT
Top exceptional features (|z-score| rank)
pos-pos: -3.73Frac I: +2.52hyd-pro: -1.93pos-pro: -1.61Frac T: +1.57hyd-pos: -1.49Frac C: +1.15pro-pro: -1.12
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.240 |
| pol-hyd | -0.913 |
| pol-pos | -1.071 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.195 |
| pol-gly | +0.000 |
| hyd-hyd | -0.225 |
| hyd-pos | -1.487 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.926 |
| hyd-gly | +0.000 |
| pos-pos | -3.727 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -1.614 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.122 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.954 |
| Frac C | +1.152 |
| Frac D | -0.826 |
| Frac E | -0.335 |
| Frac F | +0.152 |
| Frac G | -0.388 |
| Frac H | -0.229 |
| Frac I | +2.518 |
| Frac K | +0.723 |
| Frac L | +0.018 |
| Frac M | -0.832 |
| Frac N | -0.446 |
| Frac P | -0.041 |
| Frac Q | -0.269 |
| Frac R | -0.464 |
| Frac S | +0.539 |
| Frac T | +1.568 |
| Frac V | +0.237 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.229 |
| Frac D+E | -0.652 |
| Frac Polar | +0.654 |
| Frac Aliphatic | -0.181 |
| Frac Aromatic | -0.491 |
| R/K Ratio | -0.949 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.427 |
| FCR | -0.340 |
| NCPR | +0.644 |
| Hydrophobicity | +0.856 |
| Disorder Promoting | -0.552 |
| Iso point | +0.704 |
| PPII | +0.116 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 17
Residues 447–514 · 67 aa
(6.0% of protein) · Min inter-cluster distance: 7.949
Weak positive charge
Sequence
WSAEKGGNSKSKQLETKQETHCQSTPLKKHQGVSKTQSLPVTEKVTENQIPAKNSSTEPKGFTECEM
Top exceptional features (|z-score| rank)
R/K Ratio: -2.66E/D Ratio: +2.36pos-pos: -1.75Frac K: +1.57Frac C: +1.45Frac T: +1.40Frac R: -1.30Frac D: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.009 |
| pol-hyd | +0.487 |
| pol-pos | -0.028 |
| pol-neg | +0.060 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.831 |
| hyd-pos | -1.004 |
| hyd-neg | -0.923 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -1.753 |
| pos-neg | -0.584 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.697 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.873 |
| Frac C | +1.454 |
| Frac D | -1.234 |
| Frac E | +0.441 |
| Frac F | +0.037 |
| Frac G | -0.382 |
| Frac H | +0.243 |
| Frac I | -0.148 |
| Frac K | +1.568 |
| Frac L | -0.398 |
| Frac M | -0.064 |
| Frac N | +0.447 |
| Frac P | -0.757 |
| Frac Q | +0.776 |
| Frac R | -1.304 |
| Frac S | -0.084 |
| Frac T | +1.395 |
| Frac V | +0.325 |
| Frac W | +0.850 |
| Frac Y | -0.609 |
| Frac K+R | +0.298 |
| Frac D+E | -0.253 |
| Frac Polar | +1.081 |
| Frac Aliphatic | -0.926 |
| Frac Aromatic | -0.010 |
| R/K Ratio | -2.662 |
| E/D Ratio | +2.361 |
| Frac Chain Expanding | -0.534 |
| FCR | +0.005 |
| NCPR | +0.387 |
| Hydrophobicity | -0.361 |
| Disorder Promoting | -0.463 |
| Iso point | +0.401 |
| PPII | -0.139 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 19
Residues 576–606 · 30 aa
(2.7% of protein) · Min inter-cluster distance: 9.801
High negative fraction, specifically Es
Sequence
ELDMEKSQEEMDQALAESSEEQEDALNISS
Top exceptional features (|z-score| rank)
E Patch: +3.03NCPR: -2.77Frac E: +2.65Frac M: +2.60Frac D+E: +2.59Frac P: -1.60Frac Aliphatic: +1.53Frac G: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.715 |
| pol-hyd | -0.348 |
| pol-pos | +0.000 |
| pol-neg | -0.550 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.037 |
| hyd-pos | +0.000 |
| hyd-neg | +0.317 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.145 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.414 |
| Frac C | -0.582 |
| Frac D | +1.173 |
| Frac E | +2.653 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | -0.849 |
| Frac I | +0.780 |
| Frac K | -0.491 |
| Frac L | +1.184 |
| Frac M | +2.598 |
| Frac N | +0.080 |
| Frac P | -1.604 |
| Frac Q | +1.007 |
| Frac R | -1.304 |
| Frac S | +0.624 |
| Frac T | -1.284 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.236 |
| Frac D+E | +2.593 |
| Frac Polar | -0.813 |
| Frac Aliphatic | +1.534 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | +0.515 |
| Frac Chain Expanding | +0.190 |
| FCR | +1.142 |
| NCPR | -2.775 |
| Hydrophobicity | -0.192 |
| Disorder Promoting | -0.633 |
| Iso point | -1.347 |
| PPII | -0.907 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +3.026 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 24
Residues 618–669 · 51 aa
(4.5% of protein) · Min inter-cluster distance: 3.375
Weak negative charge
Sequence
VVSPESLVSTPRLELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSEDRDL
Top exceptional features (|z-score| rank)
Frac V: +1.55Frac L: +1.13Frac D: +1.13Frac A: -1.06Frac R: +1.03Frac N: -0.99Frac Chain Expanding: +0.90FCR: +0.90
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.560 |
| pol-hyd | -0.356 |
| pol-pos | -0.335 |
| pol-neg | -0.735 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.799 |
| hyd-pos | -0.122 |
| hyd-neg | -0.410 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.366 |
| pos-neg | -0.076 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.036 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.061 |
| Frac C | -0.582 |
| Frac D | +1.126 |
| Frac E | +0.119 |
| Frac F | +0.302 |
| Frac G | -0.396 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.038 |
| Frac L | +1.128 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.213 |
| Frac Q | -0.773 |
| Frac R | +1.029 |
| Frac S | +0.771 |
| Frac T | +0.036 |
| Frac V | +1.555 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.658 |
| Frac D+E | +0.630 |
| Frac Polar | -0.678 |
| Frac Aliphatic | -0.162 |
| Frac Aromatic | -0.392 |
| R/K Ratio | +0.457 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.904 |
| FCR | +0.904 |
| NCPR | -0.044 |
| Hydrophobicity | +0.010 |
| Disorder Promoting | +0.036 |
| Iso point | -0.809 |
| PPII | -0.296 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |