ARHGAP24 RHG24
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 17
Residues 332–484 · 152 aa
(20.3% of protein) · Min inter-cluster distance: 8.323
Weak positive charge
Sequence
AELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRM
Top exceptional features (|z-score| rank)
N Patch: +3.42Frac N: +2.60pos-pos: -2.25Disorder Promoting: -1.64hyd-pos: -1.57Frac Polar: +1.41pol-pos: -1.20Frac Chain Expanding: -1.19
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.095 |
| pol-hyd | -0.178 |
| pol-pos | -1.203 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.416 |
| hyd-pos | -1.575 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -2.253 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.696 |
| Frac C | -0.134 |
| Frac D | -0.601 |
| Frac E | -0.761 |
| Frac F | -0.063 |
| Frac G | -0.071 |
| Frac H | -0.368 |
| Frac I | -0.237 |
| Frac K | +0.670 |
| Frac L | -0.173 |
| Frac M | +0.861 |
| Frac N | +2.599 |
| Frac P | -0.764 |
| Frac Q | +0.250 |
| Frac R | -0.522 |
| Frac S | +0.788 |
| Frac T | +0.340 |
| Frac V | +0.612 |
| Frac W | +0.091 |
| Frac Y | -0.609 |
| Frac K+R | +0.151 |
| Frac D+E | -0.870 |
| Frac Polar | +1.413 |
| Frac Aliphatic | -0.248 |
| Frac Aromatic | -0.387 |
| R/K Ratio | -1.005 |
| E/D Ratio | -0.117 |
| Frac Chain Expanding | -1.194 |
| FCR | -0.556 |
| NCPR | +0.757 |
| Hydrophobicity | -0.056 |
| Disorder Promoting | -1.642 |
| Iso point | +0.872 |
| PPII | -0.756 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | +3.422 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.110 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 546–650 · 104 aa
(13.9% of protein) · Min inter-cluster distance: 1.383
S patches
Sequence
KQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSS
Top exceptional features (|z-score| rank)
pol-pol: +2.62pol-hyd: +2.34Frac S: +2.02S Patch: +1.58pol-neg: +1.56PPII: -1.54Frac Polar: +1.53Frac C: +1.39
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +2.618 |
| pol-hyd | +2.343 |
| pol-pos | +0.000 |
| pol-neg | +1.556 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.910 |
| hyd-pos | +0.000 |
| hyd-neg | -0.479 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.076 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.891 |
| Frac C | +1.385 |
| Frac D | +0.849 |
| Frac E | -0.487 |
| Frac F | +1.368 |
| Frac G | -0.415 |
| Frac H | +0.558 |
| Frac I | +0.069 |
| Frac K | -0.742 |
| Frac L | -0.304 |
| Frac M | -0.832 |
| Frac N | +0.862 |
| Frac P | -0.785 |
| Frac Q | -0.568 |
| Frac R | -0.351 |
| Frac S | +2.017 |
| Frac T | +0.226 |
| Frac V | +0.094 |
| Frac W | +0.367 |
| Frac Y | -0.039 |
| Frac K+R | -0.786 |
| Frac D+E | +0.033 |
| Frac Polar | +1.532 |
| Frac Aliphatic | -1.165 |
| Frac Aromatic | +1.027 |
| R/K Ratio | +0.598 |
| E/D Ratio | -1.040 |
| Frac Chain Expanding | -1.133 |
| FCR | -0.490 |
| NCPR | -0.542 |
| Hydrophobicity | +0.302 |
| Disorder Promoting | -0.933 |
| Iso point | -0.944 |
| PPII | -1.539 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.583 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |