BMP4 BMP4
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 7
Residues 89–128 · 39 aa
(9.6% of protein) · Min inter-cluster distance: 1.304
D/E-tracts
Sequence
QSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLEN
Top exceptional features (|z-score| rank)
Frac H: +2.90E/D Ratio: +2.63Frac E: +2.50neg-neg: +2.29pol-neg: +1.87hyd-neg: +1.57E Patch: +1.51NCPR: -1.44
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.397 |
| pol-hyd | -1.343 |
| pol-pos | +0.000 |
| pol-neg | +1.867 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.294 |
| hyd-pos | +0.000 |
| hyd-neg | +1.570 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.289 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.479 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | +2.499 |
| Frac F | +0.643 |
| Frac G | -0.518 |
| Frac H | +2.903 |
| Frac I | +0.392 |
| Frac K | -1.083 |
| Frac L | -0.212 |
| Frac M | -0.832 |
| Frac N | +0.656 |
| Frac P | -0.876 |
| Frac Q | -0.072 |
| Frac R | +0.221 |
| Frac S | -0.337 |
| Frac T | -0.133 |
| Frac V | -0.374 |
| Frac W | -0.508 |
| Frac Y | +0.910 |
| Frac K+R | -0.659 |
| Frac D+E | +1.324 |
| Frac Polar | +0.271 |
| Frac Aliphatic | -0.851 |
| Frac Aromatic | +0.788 |
| R/K Ratio | +1.328 |
| E/D Ratio | +2.629 |
| Frac Chain Expanding | +0.035 |
| FCR | +0.565 |
| NCPR | -1.435 |
| Hydrophobicity | -1.126 |
| Disorder Promoting | -0.126 |
| Iso point | -0.910 |
| PPII | -0.931 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.506 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 26
Residues 278–308 · 30 aa
(7.4% of protein) · Min inter-cluster distance: 33.1
R patches
Sequence
GRGHALTRRRRAKRSPKHHSQRARKKNKNC
Top exceptional features (|z-score| rank)
R Patch: +5.21Frac K+R: +4.05Frac R: +3.98NCPR: +3.90Frac H: +2.81Hydrophobicity: -2.62Frac K: +1.88Iso point: +1.81
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.620 |
| pol-hyd | +0.000 |
| pol-pos | +0.916 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.220 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.414 |
| Frac C | +1.691 |
| Frac D | -1.234 |
| Frac E | -1.354 |
| Frac F | -0.807 |
| Frac G | -0.269 |
| Frac H | +2.810 |
| Frac I | -0.900 |
| Frac K | +1.877 |
| Frac L | -0.726 |
| Frac M | -0.832 |
| Frac N | +1.149 |
| Frac P | -1.131 |
| Frac Q | -0.469 |
| Frac R | +3.984 |
| Frac S | -0.875 |
| Frac T | -0.536 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +4.055 |
| Frac D+E | -1.627 |
| Frac Polar | +0.170 |
| Frac Aliphatic | -1.185 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.294 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.865 |
| FCR | +1.431 |
| NCPR | +3.899 |
| Hydrophobicity | -2.625 |
| Disorder Promoting | +1.163 |
| Iso point | +1.814 |
| PPII | -0.665 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +5.212 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |