CASR CASR
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 11
Residues 883–965 · 82 aa
(7.6% of protein) · Min inter-cluster distance: 4.394
Q-tracts
Sequence
AARATLRRSNVSRKRSSSLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQPRCKQK
Top exceptional features (|z-score| rank)
Q Patch: +6.48Frac Q: +3.65pos-pos: +1.83S Patch: +1.72Frac Polar: +1.51Iso point: +1.48NCPR: +1.08Frac D+E: -1.07
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.664 |
| pol-hyd | +0.000 |
| pol-pos | -0.052 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.826 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.525 |
| Frac C | +0.249 |
| Frac D | -0.941 |
| Frac E | -0.804 |
| Frac F | -0.117 |
| Frac G | -0.756 |
| Frac H | -0.849 |
| Frac I | -0.285 |
| Frac K | -0.000 |
| Frac L | +0.415 |
| Frac M | -0.832 |
| Frac N | -0.207 |
| Frac P | -0.220 |
| Frac Q | +3.654 |
| Frac R | +0.630 |
| Frac S | +0.868 |
| Frac T | +0.084 |
| Frac V | -0.865 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.420 |
| Frac D+E | -1.066 |
| Frac Polar | +1.514 |
| Frac Aliphatic | -0.973 |
| Frac Aromatic | -0.668 |
| R/K Ratio | +0.294 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.772 |
| FCR | -0.527 |
| NCPR | +1.083 |
| Hydrophobicity | -0.954 |
| Disorder Promoting | +0.930 |
| Iso point | +1.477 |
| PPII | +0.510 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | +6.480 |
| R Patch | -0.247 |
| S Patch | +1.724 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 976–1016 · 40 aa
(3.7% of protein) · Min inter-cluster distance: 3.675
S patches
Sequence
LSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPL
Top exceptional features (|z-score| rank)
Frac L: +2.62Frac H: +1.90pol-hyd: +1.59Frac N: +1.42Disorder Promoting: -1.38Frac G: -1.35Frac V: -1.31Frac Chain Expanding: -1.07
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.003 |
| pol-hyd | +1.588 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.322 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.044 |
| Frac C | -0.582 |
| Frac D | -0.031 |
| Frac E | -0.602 |
| Frac F | +0.607 |
| Frac G | -1.347 |
| Frac H | +1.895 |
| Frac I | -0.900 |
| Frac K | -0.195 |
| Frac L | +2.616 |
| Frac M | +0.455 |
| Frac N | +1.417 |
| Frac P | -0.540 |
| Frac Q | +1.007 |
| Frac R | -0.313 |
| Frac S | -0.000 |
| Frac T | +0.399 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.354 |
| Frac D+E | -0.476 |
| Frac Polar | +0.662 |
| Frac Aliphatic | +0.718 |
| Frac Aromatic | -0.191 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -1.074 |
| FCR | -0.590 |
| NCPR | +0.127 |
| Hydrophobicity | +0.036 |
| Disorder Promoting | -1.382 |
| Iso point | +0.401 |
| PPII | -0.563 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 3
Residues 1023–1078 · 55 aa
(5.1% of protein) · Min inter-cluster distance: 8.792
Small negative blocks
Sequence
DLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGSTVTENVVNS
Top exceptional features (|z-score| rank)
Frac V: +4.67neg-gly: +3.32gly-gly: +2.54Disorder Promoting: -1.99pol-neg: +1.95Hydrophobicity: +1.86E Patch: +1.49Frac K+R: -1.44
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.145 |
| pol-hyd | -0.600 |
| pol-pos | +0.000 |
| pol-neg | +1.945 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +1.200 |
| hyd-hyd | -0.865 |
| hyd-pos | +0.000 |
| hyd-neg | +0.240 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.500 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.939 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +3.324 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +2.537 |
| Frac A | -1.087 |
| Frac C | -0.582 |
| Frac D | +0.079 |
| Frac E | +0.286 |
| Frac F | +0.221 |
| Frac G | +0.711 |
| Frac H | -0.849 |
| Frac I | +0.016 |
| Frac K | -1.083 |
| Frac L | +0.402 |
| Frac M | -0.832 |
| Frac N | +0.177 |
| Frac P | -0.572 |
| Frac Q | +0.403 |
| Frac R | -0.944 |
| Frac S | +0.306 |
| Frac T | +0.348 |
| Frac V | +4.668 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.436 |
| Frac D+E | +0.256 |
| Frac Polar | +0.707 |
| Frac Aliphatic | +1.089 |
| Frac Aromatic | -0.445 |
| R/K Ratio | +0.598 |
| E/D Ratio | +0.181 |
| Frac Chain Expanding | -1.281 |
| FCR | -0.748 |
| NCPR | -1.139 |
| Hydrophobicity | +1.856 |
| Disorder Promoting | -1.994 |
| Iso point | -1.347 |
| PPII | -0.856 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.492 |
| F Patch | -0.012 |
| G Patch | +1.351 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.546 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |