CD2AP CD2AP
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 24
Residues 165–210 · 45 aa
(7.0% of protein) · Min inter-cluster distance: 4.892
Weak negative charge
Sequence
EVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKK
Top exceptional features (|z-score| rank)
neg-neg: +2.25Frac V: +1.94hyd-neg: +1.82Frac T: +1.71pol-pol: -1.36Frac R: -1.30R/K Ratio: -1.29NCPR: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.360 |
| pol-hyd | -0.786 |
| pol-pos | +0.000 |
| pol-neg | -0.213 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.227 |
| hyd-pos | +0.000 |
| hyd-neg | +1.820 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.254 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.197 |
| Frac C | -0.582 |
| Frac D | +0.905 |
| Frac E | +0.316 |
| Frac F | -0.807 |
| Frac G | +0.090 |
| Frac H | -0.036 |
| Frac I | +0.220 |
| Frac K | -0.294 |
| Frac L | -0.408 |
| Frac M | -0.832 |
| Frac N | -0.276 |
| Frac P | -0.343 |
| Frac Q | -0.223 |
| Frac R | -1.304 |
| Frac S | +0.125 |
| Frac T | +1.708 |
| Frac V | +1.937 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.089 |
| Frac D+E | +0.675 |
| Frac Polar | +0.608 |
| Frac Aliphatic | +0.265 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -1.292 |
| E/D Ratio | -0.322 |
| Frac Chain Expanding | -0.484 |
| FCR | -0.205 |
| NCPR | -1.227 |
| Hydrophobicity | +0.648 |
| Disorder Promoting | +0.365 |
| Iso point | -1.145 |
| PPII | -0.382 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 25
Residues 221–265 · 44 aa
(6.9% of protein) · Min inter-cluster distance: 0.535
Blocks of positive residues
Sequence
EGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTE
Top exceptional features (|z-score| rank)
Frac T: +2.29hyd-neg: +1.83Frac A: -1.42Frac I: +1.39Frac K: +1.34E/D Ratio: +1.28neg-neg: +1.21pol-hyd: +1.20
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.970 |
| pol-hyd | +1.202 |
| pol-pos | +0.566 |
| pol-neg | +0.469 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +1.182 |
| hyd-pos | +0.925 |
| hyd-neg | +1.828 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.371 |
| pos-neg | -0.125 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.214 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | -0.687 |
| Frac E | +1.037 |
| Frac F | -0.807 |
| Frac G | -0.612 |
| Frac H | -0.849 |
| Frac I | +1.391 |
| Frac K | +1.339 |
| Frac L | +0.923 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.637 |
| Frac Q | -0.201 |
| Frac R | -0.403 |
| Frac S | +0.170 |
| Frac T | +2.285 |
| Frac V | +0.350 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.728 |
| Frac D+E | +0.466 |
| Frac Polar | +0.036 |
| Frac Aliphatic | -0.394 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -1.027 |
| E/D Ratio | +1.282 |
| Frac Chain Expanding | +0.512 |
| FCR | +0.827 |
| NCPR | +0.127 |
| Hydrophobicity | -0.109 |
| Disorder Promoting | +0.292 |
| Iso point | -0.137 |
| PPII | +0.039 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 1
Residues 327–462 · 135 aa
(21.1% of protein) · Min inter-cluster distance: 12.045
Blocks of P & polar residues
Sequence
INELDKDFPKPKKPPPPAKAPAPKPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPPPPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFD
Top exceptional features (|z-score| rank)
pol-pro: +4.14neg-pro: +4.11pro-pro: +2.81P Patch: +2.75PPII: +2.12hyd-pro: +2.04R/K Ratio: -2.02Frac K: +1.94
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.245 |
| pol-hyd | -1.751 |
| pol-pos | +0.334 |
| pol-neg | +0.802 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +4.144 |
| pol-gly | +0.000 |
| hyd-hyd | -0.229 |
| hyd-pos | -0.257 |
| hyd-neg | -0.544 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +2.044 |
| hyd-gly | +0.000 |
| pos-pos | -1.667 |
| pos-neg | -0.712 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.235 |
| pos-gly | +0.000 |
| neg-neg | +1.187 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +4.105 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +2.812 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.197 |
| Frac C | -0.582 |
| Frac D | -0.164 |
| Frac E | -0.018 |
| Frac F | +0.869 |
| Frac G | -1.108 |
| Frac H | -0.849 |
| Frac I | +0.967 |
| Frac K | +1.943 |
| Frac L | +0.441 |
| Frac M | -0.832 |
| Frac N | -0.276 |
| Frac P | +1.443 |
| Frac Q | -0.715 |
| Frac R | -0.864 |
| Frac S | -0.431 |
| Frac T | -0.453 |
| Frac V | +0.313 |
| Frac W | -0.508 |
| Frac Y | +0.269 |
| Frac K+R | +0.871 |
| Frac D+E | -0.092 |
| Frac Polar | -1.870 |
| Frac Aliphatic | +0.265 |
| Frac Aromatic | +0.533 |
| R/K Ratio | -2.023 |
| E/D Ratio | +0.260 |
| Frac Chain Expanding | +1.614 |
| FCR | +0.501 |
| NCPR | +0.643 |
| Hydrophobicity | +0.149 |
| Disorder Promoting | -0.434 |
| Iso point | +0.670 |
| PPII | +2.121 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +2.752 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.063 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 16
Residues 487–538 · 51 aa
(8.0% of protein) · Min inter-cluster distance: 13.281
Blocks of polar residues
Sequence
HLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKD
Top exceptional features (|z-score| rank)
pol-pos: +2.11hyd-pos: -2.10pol-hyd: +2.08pro-pro: -1.95pol-pol: +1.80Frac L: +1.69pol-neg: +1.69pos-pro: -1.59
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.803 |
| pol-hyd | +2.076 |
| pol-pos | +2.109 |
| pol-neg | +1.685 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.267 |
| pol-gly | +0.000 |
| hyd-hyd | -0.702 |
| hyd-pos | -2.098 |
| hyd-neg | +0.729 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.111 |
| hyd-gly | +0.000 |
| pos-pos | -0.241 |
| pos-neg | -0.057 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -1.586 |
| pos-gly | +0.000 |
| neg-neg | +1.177 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.504 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.945 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.701 |
| Frac C | -0.582 |
| Frac D | -0.290 |
| Frac E | -0.175 |
| Frac F | +0.302 |
| Frac G | -0.079 |
| Frac H | +1.303 |
| Frac I | +0.088 |
| Frac K | +1.355 |
| Frac L | +1.689 |
| Frac M | +0.177 |
| Frac N | +0.898 |
| Frac P | +0.343 |
| Frac Q | -1.207 |
| Frac R | +0.251 |
| Frac S | -0.698 |
| Frac T | -0.404 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +1.176 |
| Frac D+E | -0.273 |
| Frac Polar | -0.678 |
| Frac Aliphatic | -0.162 |
| Frac Aromatic | -0.392 |
| R/K Ratio | -0.629 |
| E/D Ratio | +0.116 |
| Frac Chain Expanding | +0.904 |
| FCR | +0.565 |
| NCPR | +0.981 |
| Hydrophobicity | -0.544 |
| Disorder Promoting | -0.668 |
| Iso point | +0.939 |
| PPII | +0.293 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |