CEP164 CE164
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 23
Residues 99–139 · 40 aa
(2.7% of protein) · Min inter-cluster distance: 30.336
K blocks
Sequence
RAKLSTSGAIKKKKKKKEKKDKKDRDPPKSSLALGSSLAP
Top exceptional features (|z-score| rank)
K Patch: +6.19pol-pos: +5.04Frac K: +4.69pos-pos: +4.16hyd-pos: +3.68Frac K+R: +3.28NCPR: +2.52pol-pol: +2.08
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +2.078 |
| pol-hyd | -1.367 |
| pol-pos | +5.042 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.072 |
| hyd-pos | +3.678 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +4.162 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.414 |
| Frac C | -0.582 |
| Frac D | +0.571 |
| Frac E | -0.978 |
| Frac F | -0.807 |
| Frac G | -0.539 |
| Frac H | -0.849 |
| Frac I | +0.360 |
| Frac K | +4.689 |
| Frac L | +1.184 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.540 |
| Frac Q | -1.207 |
| Frac R | -0.313 |
| Frac S | +0.374 |
| Frac T | -0.723 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +3.284 |
| Frac D+E | -0.476 |
| Frac Polar | -1.551 |
| Frac Aliphatic | +0.310 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -1.758 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | +1.707 |
| FCR | +1.792 |
| NCPR | +2.521 |
| Hydrophobicity | -0.786 |
| Disorder Promoting | +1.313 |
| Iso point | +1.007 |
| PPII | +0.533 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +6.190 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 152–187 · 35 aa
(2.4% of protein) · Min inter-cluster distance: 4.943
S patches
Sequence
LVDTPPSALRGSQSVSLGSSVESGRQLGELMLPSQ
Top exceptional features (|z-score| rank)
S Patch: +3.39Frac L: +3.23Hydrophobicity: +2.11Frac V: +1.82Frac Aliphatic: +1.77Disorder Promoting: -1.57Frac S: +1.55Frac Chain Expanding: -1.54
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.096 |
| pol-hyd | -0.140 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -0.919 |
| hyd-hyd | -0.402 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | -1.014 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -1.333 |
| Frac A | -0.896 |
| Frac C | -0.582 |
| Frac D | -0.547 |
| Frac E | -0.495 |
| Frac F | -0.807 |
| Frac G | +0.501 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +3.230 |
| Frac M | +0.638 |
| Frac N | -0.989 |
| Frac P | -0.388 |
| Frac Q | +0.691 |
| Frac R | -0.171 |
| Frac S | +1.552 |
| Frac T | -0.643 |
| Frac V | +1.821 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.921 |
| Frac D+E | -0.641 |
| Frac Polar | +0.733 |
| Frac Aliphatic | +1.767 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +1.025 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | -1.544 |
| FCR | -1.085 |
| NCPR | -0.122 |
| Hydrophobicity | +2.111 |
| Disorder Promoting | -1.574 |
| Iso point | -0.944 |
| PPII | -0.926 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +3.393 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 3
Residues 208–247 · 39 aa
(2.7% of protein) · Min inter-cluster distance: 3.424
Small negative blocks
Sequence
LSLLGLGEETNEEDEEESDNQSVHSSSEPLRNLHLDIGA
Top exceptional features (|z-score| rank)
L Patch: +12.52hyd-neg: +4.08Frac L: +3.46E Patch: +3.36pol-neg: +2.21neg-neg: +2.15NCPR: -2.10Disorder Promoting: -1.97
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.890 |
| pol-hyd | +1.039 |
| pol-pos | +0.000 |
| pol-neg | +2.211 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +1.743 |
| hyd-pos | +0.000 |
| hyd-neg | +4.084 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.145 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.950 |
| Frac C | -0.582 |
| Frac D | +0.617 |
| Frac E | +1.729 |
| Frac F | -0.807 |
| Frac G | -0.104 |
| Frac H | +1.027 |
| Frac I | +0.392 |
| Frac K | -1.083 |
| Frac L | +3.461 |
| Frac M | -0.832 |
| Frac N | +1.478 |
| Frac P | -1.240 |
| Frac Q | -0.639 |
| Frac R | -0.796 |
| Frac S | +0.432 |
| Frac T | -0.709 |
| Frac V | -0.374 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.338 |
| Frac D+E | +1.619 |
| Frac Polar | +0.271 |
| Frac Aliphatic | +0.823 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.598 |
| E/D Ratio | +0.515 |
| Frac Chain Expanding | -0.484 |
| FCR | +0.343 |
| NCPR | -2.105 |
| Hydrophobicity | +0.442 |
| Disorder Promoting | -1.969 |
| Iso point | -1.179 |
| PPII | -1.812 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +3.360 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | +12.520 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.257 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 19
Residues 248–414 · 166 aa
(11.4% of protein) · Min inter-cluster distance: 1.447
High negative fraction, specifically Es
Sequence
GGDFEYEESLRTSQPEEKKDVSLDSDAAGPPTPCKPSSPGADSSLSSAVGKGRQGSGARPGLPEKEENEKSEPKICRNLVTPKADPTGSEPAKASEKEAPEDTVDAGEEGSRREEAAKEPKKKASALEEGSSDASQELEISEHMKEPQLSDSIASDPKSFHGLDFG
Top exceptional features (|z-score| rank)
pol-hyd: -1.98R/K Ratio: -1.07Iso point: -0.98Frac D+E: +0.94Frac E: +0.91Disorder Promoting: +0.85FCR: +0.76Frac Chain Expanding: +0.71
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.666 |
| pol-hyd | -1.979 |
| pol-pos | +0.027 |
| pol-neg | -0.095 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.070 |
| hyd-pos | +0.452 |
| hyd-neg | -0.313 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.185 |
| pos-neg | -0.267 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.410 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.348 |
| Frac C | +0.239 |
| Frac D | +0.506 |
| Frac E | +0.909 |
| Frac F | +0.215 |
| Frac G | +0.114 |
| Frac H | -0.409 |
| Frac I | +0.011 |
| Frac K | +0.629 |
| Frac L | -0.128 |
| Frac M | -0.522 |
| Frac N | -0.603 |
| Frac P | -0.237 |
| Frac Q | -0.674 |
| Frac R | -0.588 |
| Frac S | +0.293 |
| Frac T | -0.608 |
| Frac V | -0.431 |
| Frac W | -0.508 |
| Frac Y | -0.252 |
| Frac K+R | +0.076 |
| Frac D+E | +0.938 |
| Frac Polar | -0.564 |
| Frac Aliphatic | -0.117 |
| Frac Aromatic | -0.225 |
| R/K Ratio | -1.069 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | +0.714 |
| FCR | +0.756 |
| NCPR | -0.659 |
| Hydrophobicity | -0.166 |
| Disorder Promoting | +0.853 |
| Iso point | -0.977 |
| PPII | -0.125 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.436 |
| F Patch | -0.012 |
| G Patch | +0.275 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +0.463 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.220 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.141 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 13
Residues 431–631 · 200 aa
(13.7% of protein) · Min inter-cluster distance: 10.596
Blocks of negative, P, & polar residues
Sequence
VLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHEERAQSPPRSLATEEEPPQGPEGQPEWKEAEELGEDSAASLSLQLSLQREQAPSPPAACEKGKEQHSQAEELGPGQEEAEDPEEKVAVSPTPPVSPEVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEEE
Top exceptional features (|z-score| rank)
pro-pro: +3.02L Patch: +2.77neg-pro: +2.20E/D Ratio: +1.58Frac E: +1.58Frac Q: +1.45pol-neg: +1.36pol-pro: +1.27
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.012 |
| pol-hyd | -0.162 |
| pol-pos | +0.000 |
| pol-neg | +1.356 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.272 |
| pol-gly | +0.000 |
| hyd-hyd | -0.174 |
| hyd-pos | +0.000 |
| hyd-neg | +0.553 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.980 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.166 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +2.197 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +3.021 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.323 |
| Frac C | +0.441 |
| Frac D | -0.392 |
| Frac E | +1.576 |
| Frac F | -0.807 |
| Frac G | -0.539 |
| Frac H | -0.301 |
| Frac I | -0.648 |
| Frac K | -0.106 |
| Frac L | +1.184 |
| Frac M | -0.317 |
| Frac N | -0.989 |
| Frac P | -0.044 |
| Frac Q | +1.450 |
| Frac R | -0.511 |
| Frac S | -0.450 |
| Frac T | -0.947 |
| Frac V | +0.150 |
| Frac W | -0.053 |
| Frac Y | -0.609 |
| Frac K+R | -0.420 |
| Frac D+E | +1.020 |
| Frac Polar | -0.715 |
| Frac Aliphatic | +0.718 |
| Frac Aromatic | -0.936 |
| R/K Ratio | -0.437 |
| E/D Ratio | +1.579 |
| Frac Chain Expanding | +0.544 |
| FCR | +0.493 |
| NCPR | -1.048 |
| Hydrophobicity | -0.148 |
| Disorder Promoting | +0.415 |
| Iso point | -1.045 |
| PPII | +0.619 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.242 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | +2.775 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.059 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 6
Cluster 19
Residues 634–769 · 135 aa
(9.2% of protein) · Min inter-cluster distance: 19.434
High negative fraction, specifically Es
Sequence
RLHQQKEQSLSSLRERLQKAIEEEEARMREEESQRLSWLRAQVQSSTQADEDQIRAEQEASLQKLREELESQQKAERASLEQKNRQMLEQLKEEIEASEKSEQAALNAAKEKALQQLREQLEGERKEAVATLEKE
Top exceptional features (|z-score| rank)
E/D Ratio: +2.54hyd-hyd: -2.12E Patch: +2.12Frac Q: +2.07Frac E: +1.99hyd-pos: -1.95Frac L: +1.93Frac P: -1.60
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.385 |
| pol-hyd | -0.933 |
| pol-pos | +0.132 |
| pol-neg | +1.552 |
| pol-aro | +0.000 |
| pol-ala | +0.701 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -2.122 |
| hyd-pos | -1.951 |
| hyd-neg | -0.564 |
| hyd-aro | +0.000 |
| hyd-ala | -0.736 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -1.408 |
| pos-neg | -0.920 |
| pos-aro | +0.000 |
| pos-ala | -0.803 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.267 |
| neg-aro | +0.000 |
| neg-ala | -0.188 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.100 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.754 |
| Frac C | -0.582 |
| Frac D | -0.878 |
| Frac E | +1.986 |
| Frac F | -0.807 |
| Frac G | -1.228 |
| Frac H | -0.578 |
| Frac I | +0.220 |
| Frac K | +0.364 |
| Frac L | +1.926 |
| Frac M | -0.069 |
| Frac N | -0.514 |
| Frac P | -1.604 |
| Frac Q | +2.074 |
| Frac R | +0.605 |
| Frac S | -0.542 |
| Frac T | -0.951 |
| Frac V | -0.770 |
| Frac W | +0.166 |
| Frac Y | -0.609 |
| Frac K+R | +0.675 |
| Frac D+E | +1.101 |
| Frac Polar | -0.995 |
| Frac Aliphatic | +1.473 |
| Frac Aromatic | -0.847 |
| R/K Ratio | +0.029 |
| E/D Ratio | +2.545 |
| Frac Chain Expanding | +0.340 |
| FCR | +1.271 |
| NCPR | -0.389 |
| Hydrophobicity | -0.646 |
| Disorder Promoting | -0.034 |
| Iso point | -0.876 |
| PPII | -0.367 |
| A Patch | +0.624 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +2.115 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 7
Cluster 19
Residues 833–875 · 42 aa
(2.9% of protein) · Min inter-cluster distance: 19.351
High negative fraction, specifically Es
Sequence
SLLREKRQEVEGEHERRLDKMKEEHQQVMAKAREQYEAEERK
Top exceptional features (|z-score| rank)
E Patch: +4.47Frac E: +2.58FCR: +2.42Hydrophobicity: -1.91Frac Polar: -1.89E/D Ratio: +1.82Frac K+R: +1.79Frac Chain Expanding: +1.68
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.144 |
| pol-hyd | -0.155 |
| pol-pos | +0.930 |
| pol-neg | -0.270 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.522 |
| hyd-pos | -0.692 |
| hyd-neg | +0.371 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.147 |
| pos-neg | -0.314 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.501 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.110 |
| Frac C | -0.582 |
| Frac D | -0.661 |
| Frac E | +2.582 |
| Frac F | -0.807 |
| Frac G | -0.962 |
| Frac H | +0.893 |
| Frac I | -0.900 |
| Frac K | +1.031 |
| Frac L | +0.365 |
| Frac M | +1.618 |
| Frac N | -0.989 |
| Frac P | -1.604 |
| Frac Q | +0.902 |
| Frac R | +1.529 |
| Frac S | -1.517 |
| Frac T | -1.284 |
| Frac V | +0.429 |
| Frac W | -0.508 |
| Frac Y | +0.801 |
| Frac K+R | +1.788 |
| Frac D+E | +1.661 |
| Frac Polar | -1.891 |
| Frac Aliphatic | +0.524 |
| Frac Aromatic | -0.236 |
| R/K Ratio | +0.029 |
| E/D Ratio | +1.822 |
| Frac Chain Expanding | +1.683 |
| FCR | +2.421 |
| NCPR | -0.080 |
| Hydrophobicity | -1.913 |
| Disorder Promoting | +0.137 |
| Iso point | -0.137 |
| PPII | -0.255 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +4.472 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 8
Cluster 26
Residues 895–930 · 35 aa
(2.4% of protein) · Min inter-cluster distance: 3.11
R patches
Sequence
ERELETVRQEQHKRLEDLRRRHREQERKLQDLELD
Top exceptional features (|z-score| rank)
Frac L: +3.23Frac R: +3.23R Patch: +3.10FCR: +2.87Hydrophobicity: -2.40Frac Chain Expanding: +2.21Frac K+R: +2.10Frac E: +2.08
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.681 |
| pol-hyd | +0.214 |
| pol-pos | -0.931 |
| pol-neg | -0.611 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.112 |
| hyd-pos | +0.230 |
| hyd-neg | -1.405 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.417 |
| pos-neg | -0.121 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.389 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | +0.829 |
| Frac E | +2.081 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | +1.241 |
| Frac I | -0.900 |
| Frac K | -0.068 |
| Frac L | +3.230 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -1.604 |
| Frac Q | +1.324 |
| Frac R | +3.228 |
| Frac S | -1.874 |
| Frac T | -0.643 |
| Frac V | -0.267 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +2.103 |
| Frac D+E | +1.990 |
| Frac Polar | -1.797 |
| Frac Aliphatic | -0.098 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +1.025 |
| E/D Ratio | +0.515 |
| Frac Chain Expanding | +2.213 |
| FCR | +2.874 |
| NCPR | -0.122 |
| Hydrophobicity | -2.397 |
| Disorder Promoting | -0.034 |
| Iso point | -0.271 |
| PPII | -0.631 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +3.095 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 9
Cluster 24
Residues 1195–1263 · 68 aa
(4.7% of protein) · Min inter-cluster distance: 2.604
Weak negative charge
Sequence
LESSLWEEASDEGTLGGSPTKKAVTFDLSDMDSLSSESSESFSPPHREWWRQQRIDSTPSLTSRKIHG
Top exceptional features (|z-score| rank)
Frac W: +3.51pos-pos: +2.24pos-neg: +1.93Frac Aromatic: +1.62pol-pol: -1.44Frac S: +1.43S Patch: +1.35pol-hyd: -1.25
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.438 |
| pol-hyd | -1.253 |
| pol-pos | -0.287 |
| pol-neg | -1.171 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.934 |
| hyd-pos | -0.248 |
| hyd-neg | -0.860 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +2.242 |
| pos-neg | +1.928 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.264 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.881 |
| Frac C | -0.582 |
| Frac D | +0.536 |
| Frac E | +0.193 |
| Frac F | +0.856 |
| Frac G | -0.396 |
| Frac H | +0.227 |
| Frac I | +0.583 |
| Frac K | -0.300 |
| Frac L | +0.847 |
| Frac M | -0.075 |
| Frac N | -0.989 |
| Frac P | -0.769 |
| Frac Q | -0.556 |
| Frac R | -0.138 |
| Frac S | +1.432 |
| Frac T | +0.366 |
| Frac V | -0.774 |
| Frac W | +3.506 |
| Frac Y | -0.609 |
| Frac K+R | -0.315 |
| Frac D+E | +0.404 |
| Frac Polar | +0.286 |
| Frac Aliphatic | -0.482 |
| Frac Aromatic | +1.617 |
| R/K Ratio | +0.102 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | -0.435 |
| FCR | +0.098 |
| NCPR | -0.513 |
| Hydrophobicity | +0.317 |
| Disorder Promoting | -0.404 |
| Iso point | -0.910 |
| PPII | -1.182 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.347 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |