CHD1L CHD1L
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 19
Residues 551–592 · 41 aa
(4.6% of protein) · Min inter-cluster distance: 1.448
High negative fraction, specifically Es
Sequence
SDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSF
Top exceptional features (|z-score| rank)
Frac Aromatic: +2.51Frac Y: +2.28Frac F: +1.95pos-neg: -1.53pol-pos: -1.38Frac V: -1.31Frac T: -1.28FCR: +1.27
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.376 |
| pol-hyd | +0.000 |
| pol-pos | -1.381 |
| pol-neg | -0.962 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.622 |
| pos-neg | -1.528 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -1.107 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.078 |
| Frac C | -0.582 |
| Frac D | +1.114 |
| Frac E | +0.845 |
| Frac F | +1.952 |
| Frac G | +0.230 |
| Frac H | +0.043 |
| Frac I | -0.900 |
| Frac K | +1.083 |
| Frac L | -0.284 |
| Frac M | +0.423 |
| Frac N | -0.207 |
| Frac P | -0.912 |
| Frac Q | -0.667 |
| Frac R | -0.337 |
| Frac S | -0.046 |
| Frac T | -1.284 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | +2.280 |
| Frac K+R | +0.582 |
| Frac D+E | +1.180 |
| Frac Polar | -0.885 |
| Frac Aliphatic | -0.973 |
| Frac Aromatic | +2.512 |
| R/K Ratio | -0.864 |
| E/D Ratio | -0.117 |
| Frac Chain Expanding | +0.832 |
| FCR | +1.269 |
| NCPR | -0.510 |
| Hydrophobicity | -1.066 |
| Disorder Promoting | +0.053 |
| Iso point | -0.876 |
| PPII | -0.905 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 23
Residues 605–673 · 68 aa
(7.6% of protein) · Min inter-cluster distance: 9.698
K blocks
Sequence
ASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKK
Top exceptional features (|z-score| rank)
Frac K+R: +2.60hyd-pos: +2.47pos-pos: +2.42pos-neg: +2.06Frac K: +2.05FCR: +2.01E/D Ratio: +1.82hyd-hyd: +1.68
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.423 |
| pol-hyd | +0.767 |
| pol-pos | -0.278 |
| pol-neg | +0.326 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +1.677 |
| hyd-pos | +2.471 |
| hyd-neg | +1.345 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +2.416 |
| pos-neg | +2.061 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.901 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.071 |
| Frac C | -0.582 |
| Frac D | -0.880 |
| Frac E | +1.077 |
| Frac F | -0.807 |
| Frac G | -0.396 |
| Frac H | -0.311 |
| Frac I | +0.583 |
| Frac K | +2.051 |
| Frac L | +0.847 |
| Frac M | -0.832 |
| Frac N | -0.517 |
| Frac P | -1.186 |
| Frac Q | +0.095 |
| Frac R | +1.612 |
| Frac S | -0.772 |
| Frac T | -0.954 |
| Frac V | +0.301 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +2.603 |
| Frac D+E | +0.404 |
| Frac Polar | -1.450 |
| Frac Aliphatic | +0.478 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.310 |
| E/D Ratio | +1.822 |
| Frac Chain Expanding | +1.499 |
| FCR | +2.008 |
| NCPR | +1.407 |
| Hydrophobicity | -1.178 |
| Disorder Promoting | +0.388 |
| Iso point | +1.007 |
| PPII | -0.059 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |