CHRM3 ACM3
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 6
Residues 264–306 · 42 aa
(7.1% of protein) · Min inter-cluster distance: 8.601
S patches
Sequence
LAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRR
Top exceptional features (|z-score| rank)
pos-pos: +1.60E/D Ratio: +1.58Frac Chain Expanding: -1.45PPII: -1.40S Patch: +1.40Frac Polar: +1.39Frac P: -1.27Frac D: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.013 |
| pol-hyd | -0.156 |
| pol-pos | -0.451 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.941 |
| hyd-pos | +0.193 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.604 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.110 |
| Frac C | +1.041 |
| Frac D | -1.234 |
| Frac E | +0.077 |
| Frac F | +0.540 |
| Frac G | -0.192 |
| Frac H | +0.022 |
| Frac I | -0.900 |
| Frac K | -0.660 |
| Frac L | +0.365 |
| Frac M | +0.393 |
| Frac N | +0.538 |
| Frac P | -1.266 |
| Frac Q | +0.902 |
| Frac R | +0.584 |
| Frac S | +0.981 |
| Frac T | +0.319 |
| Frac V | -0.441 |
| Frac W | -0.508 |
| Frac Y | +0.801 |
| Frac K+R | -0.102 |
| Frac D+E | -0.531 |
| Frac Polar | +1.388 |
| Frac Aliphatic | -0.253 |
| Frac Aromatic | +0.652 |
| R/K Ratio | +0.833 |
| E/D Ratio | +1.579 |
| Frac Chain Expanding | -1.447 |
| FCR | -0.466 |
| NCPR | +0.334 |
| Hydrophobicity | +0.064 |
| Disorder Promoting | -0.719 |
| Iso point | +0.536 |
| PPII | -1.403 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.402 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 4
Residues 317–357 · 40 aa
(6.8% of protein) · Min inter-cluster distance: 11.686
Weak negative charge, high N fraction
Sequence
KSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDI
Top exceptional features (|z-score| rank)
Frac W: +4.04Frac D: +2.38Frac S: +2.25Frac N: +2.22NCPR: -1.61PPII: -1.36Frac G: -1.35Frac V: -1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.367 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | -0.415 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.715 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.414 |
| Frac C | -0.582 |
| Frac D | +2.377 |
| Frac E | +0.149 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | +0.065 |
| Frac I | +0.360 |
| Frac K | -0.195 |
| Frac L | -0.965 |
| Frac M | +0.455 |
| Frac N | +2.219 |
| Frac P | -1.249 |
| Frac Q | -0.100 |
| Frac R | -1.304 |
| Frac S | +2.248 |
| Frac T | -1.284 |
| Frac V | -1.311 |
| Frac W | +4.041 |
| Frac Y | -0.609 |
| Frac K+R | -1.015 |
| Frac D+E | +1.250 |
| Frac Polar | +0.662 |
| Frac Aliphatic | -0.506 |
| Frac Aromatic | +0.740 |
| R/K Ratio | -1.292 |
| E/D Ratio | -1.013 |
| Frac Chain Expanding | -0.568 |
| FCR | +0.276 |
| NCPR | -1.614 |
| Hydrophobicity | -0.999 |
| Disorder Promoting | -0.483 |
| Iso point | -1.179 |
| PPII | -1.360 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.931 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |