COL4A6 CO4A6
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 22
Residues 94–333 · 239 aa
(14.1% of protein) · Min inter-cluster distance: 50.241
Well-mixed P and G
Sequence
GPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQG
Top exceptional features (|z-score| rank)
G Patch: +9.65gly-gly: -4.42Frac G: +3.86hyd-gly: -3.53pol-gly: -3.53pro-gly: -2.91R/K Ratio: -1.96Frac F: +1.80
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.593 |
| pol-hyd | +0.219 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.536 |
| pol-gly | -3.527 |
| hyd-hyd | -1.074 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.327 |
| hyd-gly | -3.531 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.848 |
| pro-gly | -2.906 |
| gly-gly | -4.416 |
| Frac A | -0.960 |
| Frac C | -0.297 |
| Frac D | -0.529 |
| Frac E | -0.851 |
| Frac F | +1.796 |
| Frac G | +3.862 |
| Frac H | -0.696 |
| Frac I | +0.154 |
| Frac K | +0.106 |
| Frac L | +0.357 |
| Frac M | +0.245 |
| Frac N | -0.452 |
| Frac P | +1.304 |
| Frac Q | -0.281 |
| Frac R | -1.139 |
| Frac S | -1.497 |
| Frac T | -0.721 |
| Frac V | -0.241 |
| Frac W | -0.508 |
| Frac Y | -0.361 |
| Frac K+R | -0.681 |
| Frac D+E | -0.905 |
| Frac Polar | +0.557 |
| Frac Aliphatic | -0.630 |
| Frac Aromatic | +0.748 |
| R/K Ratio | -1.963 |
| E/D Ratio | -0.408 |
| Frac Chain Expanding | -0.385 |
| FCR | -1.126 |
| NCPR | +0.236 |
| Hydrophobicity | +1.236 |
| Disorder Promoting | -0.275 |
| Iso point | +0.536 |
| PPII | +0.226 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +9.654 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +0.327 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.406 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 22
Residues 360–390 · 30 aa
(1.8% of protein) · Min inter-cluster distance: 10.411
Well-mixed P and G
Sequence
PGDPGVPGLPGLKGDEGIQGLRGPSGVPGL
Top exceptional features (|z-score| rank)
G Patch: +10.07Frac G: +4.04P Patch: +3.24Frac L: +2.14Hydrophobicity: +1.75Frac A: -1.42Frac S: -1.37gly-gly: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.000 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.254 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.933 |
| hyd-gly | -1.307 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.397 |
| pro-gly | -0.955 |
| gly-gly | -1.350 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | +0.370 |
| Frac E | -0.853 |
| Frac F | -0.807 |
| Frac G | +4.043 |
| Frac H | -0.849 |
| Frac I | +0.780 |
| Frac K | -0.491 |
| Frac L | +2.139 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.233 |
| Frac Q | -0.469 |
| Frac R | -0.643 |
| Frac S | -1.374 |
| Frac T | -1.284 |
| Frac V | +1.125 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.795 |
| Frac D+E | -0.476 |
| Frac Polar | +0.170 |
| Frac Aliphatic | +0.446 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | -0.147 |
| FCR | -0.879 |
| NCPR | -0.163 |
| Hydrophobicity | +1.751 |
| Disorder Promoting | -0.633 |
| Iso point | -0.977 |
| PPII | +0.018 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +10.074 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +3.244 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 22
Residues 391–473 · 82 aa
(4.8% of protein) · Min inter-cluster distance: 16.785
Well-mixed P and G
Sequence
ALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLK
Top exceptional features (|z-score| rank)
G Patch: +7.44Frac G: +2.79pol-pro: +1.90hyd-gly: -1.71pro-gly: -1.54Frac L: +1.46Frac S: -1.32hyd-pro: +1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.086 |
| pol-hyd | -0.607 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.895 |
| pol-gly | +0.095 |
| hyd-hyd | -1.188 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.310 |
| hyd-gly | -1.709 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.372 |
| pro-gly | -1.544 |
| gly-gly | -1.088 |
| Frac A | -0.525 |
| Frac C | -0.582 |
| Frac D | -0.647 |
| Frac E | -0.437 |
| Frac F | +1.262 |
| Frac G | +2.794 |
| Frac H | -0.403 |
| Frac I | -0.285 |
| Frac K | -0.217 |
| Frac L | +1.463 |
| Frac M | -0.832 |
| Frac N | +0.184 |
| Frac P | +0.991 |
| Frac Q | -0.397 |
| Frac R | -0.579 |
| Frac S | -1.325 |
| Frac T | -0.189 |
| Frac V | -0.865 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.548 |
| Frac D+E | -0.645 |
| Frac Polar | +0.434 |
| Frac Aliphatic | -0.376 |
| Frac Aromatic | +0.240 |
| R/K Ratio | -0.369 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.279 |
| FCR | -0.844 |
| NCPR | +0.127 |
| Hydrophobicity | +0.866 |
| Disorder Promoting | -0.166 |
| Iso point | -0.137 |
| PPII | +0.044 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +7.437 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.174 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 22
Residues 484–655 · 171 aa
(10.1% of protein) · Min inter-cluster distance: 59.642
Well-mixed P and G
Sequence
DGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITL
Top exceptional features (|z-score| rank)
RG Frac: +13.34G Patch: +9.65Frac G: +4.04gly-gly: -3.32pol-gly: -2.75pro-gly: -2.70hyd-gly: -1.83pol-pol: +1.53
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.527 |
| pol-hyd | +0.558 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.920 |
| pol-gly | -2.751 |
| hyd-hyd | +0.762 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.139 |
| hyd-gly | -1.828 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.444 |
| pro-gly | -2.697 |
| gly-gly | -3.316 |
| Frac A | -0.991 |
| Frac C | -0.582 |
| Frac D | -0.108 |
| Frac E | -0.914 |
| Frac F | -0.146 |
| Frac G | +4.043 |
| Frac H | -0.635 |
| Frac I | +0.574 |
| Frac K | -0.044 |
| Frac L | +1.334 |
| Frac M | -0.531 |
| Frac N | -0.614 |
| Frac P | +1.133 |
| Frac Q | -0.430 |
| Frac R | -0.725 |
| Frac S | -1.348 |
| Frac T | -0.890 |
| Frac V | -0.456 |
| Frac W | +0.024 |
| Frac Y | -0.609 |
| Frac K+R | -0.516 |
| Frac D+E | -0.752 |
| Frac Polar | +0.550 |
| Frac Aliphatic | -0.308 |
| Frac Aromatic | -0.469 |
| R/K Ratio | -0.773 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | -0.248 |
| FCR | -0.904 |
| NCPR | +0.229 |
| Hydrophobicity | +1.115 |
| Disorder Promoting | +0.092 |
| Iso point | +0.603 |
| PPII | -0.021 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +9.647 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.302 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | +13.344 |
IDR 5
Cluster 22
Residues 661–900 · 239 aa
(14.1% of protein) · Min inter-cluster distance: 58.834
Well-mixed P and G
Sequence
SYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG
Top exceptional features (|z-score| rank)
G Patch: +9.24RG Frac: +5.98gly-gly: -4.34pro-gly: -3.75Frac G: +3.73pos-gly: -3.47pol-gly: -3.44hyd-gly: -2.71
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.090 |
| pol-hyd | +0.103 |
| pol-pos | +0.275 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.767 |
| pol-gly | -3.439 |
| hyd-hyd | +0.221 |
| hyd-pos | +0.537 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.981 |
| hyd-gly | -2.709 |
| pos-pos | +1.053 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.116 |
| pos-gly | -3.469 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -2.463 |
| pro-gly | -3.745 |
| gly-gly | -4.339 |
| Frac A | -0.960 |
| Frac C | -0.582 |
| Frac D | -0.932 |
| Frac E | -0.914 |
| Frac F | +0.849 |
| Frac G | +3.727 |
| Frac H | -0.237 |
| Frac I | +0.154 |
| Frac K | +0.478 |
| Frac L | +1.076 |
| Frac M | -0.616 |
| Frac N | -0.721 |
| Frac P | +0.889 |
| Frac Q | -0.744 |
| Frac R | -0.973 |
| Frac S | -0.682 |
| Frac T | -0.627 |
| Frac V | -0.394 |
| Frac W | -0.508 |
| Frac Y | -0.113 |
| Frac K+R | -0.293 |
| Frac D+E | -1.145 |
| Frac Polar | +0.845 |
| Frac Aliphatic | -0.562 |
| Frac Aromatic | +0.280 |
| R/K Ratio | -1.696 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.597 |
| FCR | -1.054 |
| NCPR | +0.673 |
| Hydrophobicity | +1.243 |
| Disorder Promoting | +0.101 |
| Iso point | +0.872 |
| PPII | -0.254 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +9.237 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.387 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | +5.982 |
IDR 6
Cluster 22
Residues 914–1100 · 186 aa
(11.0% of protein) · Min inter-cluster distance: 66.422
Well-mixed P and G
Sequence
GIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDG
Top exceptional features (|z-score| rank)
G Patch: +9.44RG Frac: +8.05Frac G: +3.61pos-gly: -2.88gly-gly: -2.83pro-gly: -2.56pol-gly: -2.29hyd-gly: -2.15
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.276 |
| pol-hyd | +0.321 |
| pol-pos | +0.378 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.669 |
| pol-gly | -2.285 |
| hyd-hyd | +0.206 |
| hyd-pos | -0.636 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.575 |
| hyd-gly | -2.154 |
| pos-pos | -1.120 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.088 |
| pos-gly | -2.882 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.490 |
| pro-gly | -2.565 |
| gly-gly | -2.825 |
| Frac A | -0.927 |
| Frac C | -0.582 |
| Frac D | -0.587 |
| Frac E | -0.950 |
| Frac F | +0.409 |
| Frac G | +3.608 |
| Frac H | -0.849 |
| Frac I | +1.539 |
| Frac K | +0.158 |
| Frac L | -0.141 |
| Frac M | +0.275 |
| Frac N | -0.299 |
| Frac P | +0.608 |
| Frac Q | -0.731 |
| Frac R | -0.238 |
| Frac S | -0.504 |
| Frac T | -0.560 |
| Frac V | -0.722 |
| Frac W | -0.019 |
| Frac Y | -0.609 |
| Frac K+R | -0.041 |
| Frac D+E | -1.008 |
| Frac Polar | +0.890 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | -0.121 |
| R/K Ratio | -0.388 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -0.484 |
| FCR | -0.786 |
| NCPR | +0.736 |
| Hydrophobicity | +0.882 |
| Disorder Promoting | +0.178 |
| Iso point | +1.208 |
| PPII | -0.405 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +9.443 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.327 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | +8.047 |
IDR 7
Cluster 22
Residues 1129–1160 · 31 aa
(1.8% of protein) · Min inter-cluster distance: 7.656
Well-mixed P and G
Sequence
GFPGVAGMRGEPGLPGSSGHQGAIGPLGSPG
Top exceptional features (|z-score| rank)
G Patch: +10.81Frac G: +4.39pol-hyd: +2.07Hydrophobicity: +2.04FCR: -1.76pol-pro: +1.60pol-pol: +1.60Frac Chain Expanding: -1.57
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.596 |
| pol-hyd | +2.069 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.604 |
| pol-gly | -0.785 |
| hyd-hyd | -1.459 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.158 |
| hyd-gly | -1.534 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.428 |
| pro-gly | -1.269 |
| gly-gly | -1.214 |
| Frac A | -0.237 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.869 |
| Frac F | +1.017 |
| Frac G | +4.391 |
| Frac H | +0.331 |
| Frac I | +0.726 |
| Frac K | -1.083 |
| Frac L | +0.167 |
| Frac M | +0.828 |
| Frac N | -0.989 |
| Frac P | +0.684 |
| Frac Q | -0.493 |
| Frac R | -0.665 |
| Frac S | -0.423 |
| Frac T | -1.284 |
| Frac V | -0.132 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.250 |
| Frac D+E | -1.256 |
| Frac Polar | +1.313 |
| Frac Aliphatic | +0.323 |
| Frac Aromatic | +0.079 |
| R/K Ratio | +0.598 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -1.572 |
| FCR | -1.763 |
| NCPR | +0.127 |
| Hydrophobicity | +2.040 |
| Disorder Promoting | +0.082 |
| Iso point | +0.939 |
| PPII | -0.887 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +10.812 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 8
Cluster 22
Residues 1171–1461 · 290 aa
(17.1% of protein) · Min inter-cluster distance: 56.916
Well-mixed P and G
Sequence
GLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG
Top exceptional features (|z-score| rank)
G Patch: +9.71RG Frac: +6.72gly-gly: -4.11pro-gly: -4.02Frac G: +3.73hyd-gly: -3.39pro-pro: -2.83pol-gly: -2.43
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.080 |
| pol-hyd | +0.149 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.578 |
| pol-gly | -2.432 |
| hyd-hyd | -0.646 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.633 |
| hyd-gly | -3.391 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -2.832 |
| pro-gly | -4.022 |
| gly-gly | -4.109 |
| Frac A | -0.661 |
| Frac C | -0.582 |
| Frac D | -0.238 |
| Frac E | -1.043 |
| Frac F | +0.558 |
| Frac G | +3.727 |
| Frac H | -0.597 |
| Frac I | +0.838 |
| Frac K | -0.287 |
| Frac L | +0.591 |
| Frac M | +0.055 |
| Frac N | -0.768 |
| Frac P | +1.428 |
| Frac Q | -0.215 |
| Frac R | -0.826 |
| Frac S | -1.357 |
| Frac T | -0.587 |
| Frac V | -0.681 |
| Frac W | -0.508 |
| Frac Y | -0.405 |
| Frac K+R | -0.765 |
| Frac D+E | -0.913 |
| Frac Polar | +0.544 |
| Frac Aliphatic | -0.267 |
| Frac Aromatic | -0.095 |
| R/K Ratio | -0.724 |
| E/D Ratio | -1.389 |
| Frac Chain Expanding | -0.368 |
| FCR | -1.187 |
| NCPR | +0.187 |
| Hydrophobicity | +1.244 |
| Disorder Promoting | +0.275 |
| Iso point | +0.536 |
| PPII | +0.339 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +9.705 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.775 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | +6.725 |