EYA1 EYA1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 10
Residues 0–111 · 111 aa
(18.8% of protein) · Min inter-cluster distance: 0.729
Well-mixed hydrophobics, enriched in M
Sequence
MEMQDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETASTTADGSLNNFSGSAIGSSSFSPRPTHQFSPPQIYPSNRPYPHILPTPSSQTMAAYGQ
Top exceptional features (|z-score| rank)
hyd-hyd: -1.77Frac S: +1.50Frac Chain Expanding: -1.49Frac M: +1.49Frac Polar: +1.46S Patch: +1.45FCR: -1.39pol-hyd: -1.22
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.054 |
| pol-hyd | -1.215 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.302 |
| pol-gly | +0.000 |
| hyd-hyd | -1.773 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.610 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.016 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.594 |
| Frac C | -0.582 |
| Frac D | -0.801 |
| Frac E | -0.677 |
| Frac F | +0.721 |
| Frac G | -0.182 |
| Frac H | +0.469 |
| Frac I | +0.917 |
| Frac K | -0.763 |
| Frac L | -0.391 |
| Frac M | +1.486 |
| Frac N | +1.034 |
| Frac P | +0.185 |
| Frac Q | -0.210 |
| Frac R | -0.768 |
| Frac S | +1.502 |
| Frac T | +0.737 |
| Frac V | -0.982 |
| Frac W | -0.508 |
| Frac Y | +0.992 |
| Frac K+R | -1.081 |
| Frac D+E | -0.901 |
| Frac Polar | +1.464 |
| Frac Aliphatic | -0.421 |
| Frac Aromatic | +0.891 |
| R/K Ratio | +0.170 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -1.487 |
| FCR | -1.386 |
| NCPR | -0.030 |
| Hydrophobicity | +0.629 |
| Disorder Promoting | -0.973 |
| Iso point | -0.271 |
| PPII | -0.428 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.453 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 28
Residues 231–322 · 91 aa
(15.4% of protein) · Min inter-cluster distance: 3.002
High aromatic fraction, specifically Ys
Sequence
SSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSDLE
Top exceptional features (|z-score| rank)
T Patch: +3.51RG Frac: +2.52pol-neg: +2.21Frac Y: +1.99E/D Ratio: -1.49Frac T: +1.43pro-pro: +1.42R Patch: +1.29
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.296 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +2.210 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.218 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.773 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.951 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.420 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.614 |
| Frac C | -0.582 |
| Frac D | +0.617 |
| Frac E | -0.858 |
| Frac F | -0.807 |
| Frac G | -0.459 |
| Frac H | -0.045 |
| Frac I | +0.762 |
| Frac K | -0.693 |
| Frac L | -0.737 |
| Frac M | -0.266 |
| Frac N | +0.773 |
| Frac P | +0.422 |
| Frac Q | -0.477 |
| Frac R | +0.221 |
| Frac S | +0.926 |
| Frac T | +1.428 |
| Frac V | -0.910 |
| Frac W | -0.508 |
| Frac Y | +1.994 |
| Frac K+R | -0.369 |
| Frac D+E | -0.362 |
| Frac Polar | +0.884 |
| Frac Aliphatic | -1.209 |
| Frac Aromatic | +0.515 |
| R/K Ratio | +0.901 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | -0.299 |
| FCR | -0.514 |
| NCPR | +0.031 |
| Hydrophobicity | -0.499 |
| Disorder Promoting | +0.203 |
| Iso point | -0.406 |
| PPII | +0.010 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.161 |
| Q Patch | -0.160 |
| R Patch | +1.295 |
| S Patch | -0.481 |
| T Patch | +3.510 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | +2.518 |