FAT1 FAT1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 13
Residues 4297–4331 · 34 aa
(0.7% of protein) · Min inter-cluster distance: 0.36
Blocks of negative, P, & polar residues
Sequence
AVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFD
Top exceptional features (|z-score| rank)
neg-pro: +3.59E/D Ratio: -2.71S Patch: +2.51Frac W: +2.17P Patch: +2.16hyd-pro: +1.97Frac V: +1.91Frac P: +1.73
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.751 |
| pol-hyd | +0.467 |
| pol-pos | +0.000 |
| pol-neg | +0.101 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.093 |
| pol-gly | +0.000 |
| hyd-hyd | +0.442 |
| hyd-pos | +0.000 |
| hyd-neg | +0.771 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.969 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.251 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +3.592 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.891 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.199 |
| Frac C | +1.424 |
| Frac D | +1.598 |
| Frac E | -1.354 |
| Frac F | +0.856 |
| Frac G | -1.347 |
| Frac H | -0.849 |
| Frac I | +0.583 |
| Frac K | -0.561 |
| Frac L | -0.838 |
| Frac M | -0.832 |
| Frac N | +0.898 |
| Frac P | +1.733 |
| Frac Q | -0.556 |
| Frac R | -1.304 |
| Frac S | +1.212 |
| Frac T | -1.284 |
| Frac V | +1.913 |
| Frac W | +2.168 |
| Frac Y | -0.609 |
| Frac K+R | -1.288 |
| Frac D+E | -0.273 |
| Frac Polar | -0.582 |
| Frac Aliphatic | +0.478 |
| Frac Aromatic | +1.069 |
| R/K Ratio | -0.864 |
| E/D Ratio | -2.708 |
| Frac Chain Expanding | +0.012 |
| FCR | -1.049 |
| NCPR | -0.641 |
| Hydrophobicity | +1.349 |
| Disorder Promoting | -1.725 |
| Iso point | -1.246 |
| PPII | +1.423 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +2.159 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.510 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 4340–4376 · 36 aa
(0.8% of protein) · Min inter-cluster distance: 2.167
S patches
Sequence
PCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESC
Top exceptional features (|z-score| rank)
Frac C: +3.21S Patch: +2.34Frac S: +2.29E/D Ratio: +1.82Frac L: +1.50Frac G: -1.35Frac T: -1.28Frac D: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.925 |
| pol-hyd | -0.543 |
| pol-pos | +0.712 |
| pol-neg | -0.156 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.461 |
| pol-gly | +0.000 |
| hyd-hyd | -0.382 |
| hyd-pos | -0.437 |
| hyd-neg | -0.911 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.235 |
| hyd-gly | +0.000 |
| pos-pos | +0.359 |
| pos-neg | -0.498 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -1.228 |
| pos-gly | +0.000 |
| neg-neg | +0.078 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.310 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.145 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.911 |
| Frac C | +3.207 |
| Frac D | -1.234 |
| Frac E | +0.733 |
| Frac F | +0.764 |
| Frac G | -1.347 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +0.397 |
| Frac L | +1.502 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.028 |
| Frac Q | +0.638 |
| Frac R | -0.754 |
| Frac S | +2.289 |
| Frac T | -1.284 |
| Frac V | -0.296 |
| Frac W | -0.508 |
| Frac Y | +1.036 |
| Frac K+R | -0.207 |
| Frac D+E | -0.028 |
| Frac Polar | +0.334 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | +0.947 |
| R/K Ratio | -0.864 |
| E/D Ratio | +1.822 |
| Frac Chain Expanding | -0.203 |
| FCR | -0.157 |
| NCPR | -0.115 |
| Hydrophobicity | +0.505 |
| Disorder Promoting | -0.933 |
| Iso point | -0.809 |
| PPII | +0.132 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.344 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 1
Residues 4433–4483 · 50 aa
(1.1% of protein) · Min inter-cluster distance: 17.384
Blocks of P & polar residues
Sequence
DFPPPPEDFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQR
Top exceptional features (|z-score| rank)
pol-pro: +4.75Frac F: +3.72pol-pol: +3.04pol-neg: +2.18Frac Aromatic: +1.86Frac P: +1.80pro-pro: +1.76R/K Ratio: +1.56
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +3.045 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +2.180 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +4.751 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.107 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.349 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.760 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.047 |
| Frac C | -0.582 |
| Frac D | +0.691 |
| Frac E | -0.152 |
| Frac F | +3.718 |
| Frac G | -0.701 |
| Frac H | -0.118 |
| Frac I | +0.108 |
| Frac K | -1.083 |
| Frac L | +0.038 |
| Frac M | +0.197 |
| Frac N | +0.294 |
| Frac P | +1.800 |
| Frac Q | -0.321 |
| Frac R | +0.282 |
| Frac S | -0.075 |
| Frac T | -1.284 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.619 |
| Frac D+E | +0.214 |
| Frac Polar | -1.207 |
| Frac Aliphatic | -0.424 |
| Frac Aromatic | +1.858 |
| R/K Ratio | +1.564 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.999 |
| FCR | -0.244 |
| NCPR | -0.569 |
| Hydrophobicity | +0.116 |
| Disorder Promoting | -0.394 |
| Iso point | -0.977 |
| PPII | +1.368 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.546 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.875 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 28
Residues 4494–4525 · 31 aa
(0.7% of protein) · Min inter-cluster distance: 9.195
High aromatic fraction, specifically Ys
Sequence
PLDMSEPQTKGTGENSTCREPHAPYPPGYQR
Top exceptional features (|z-score| rank)
Frac Y: +3.21P Patch: +2.05Frac Aliphatic: -1.78pol-pro: +1.77Frac C: +1.62Frac V: -1.31Frac Aromatic: +1.28Frac P: +1.14
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.077 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | -0.704 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.766 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.726 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.619 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.583 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.829 |
| Frac C | +1.618 |
| Frac D | -0.458 |
| Frac E | +0.100 |
| Frac F | -0.807 |
| Frac G | +0.217 |
| Frac H | +0.331 |
| Frac I | -0.900 |
| Frac K | -0.510 |
| Frac L | -0.757 |
| Frac M | +0.828 |
| Frac N | +0.046 |
| Frac P | +1.141 |
| Frac Q | +0.222 |
| Frac R | -0.025 |
| Frac S | -0.907 |
| Frac T | +0.887 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | +3.212 |
| Frac K+R | -0.397 |
| Frac D+E | -0.142 |
| Frac Polar | +0.361 |
| Frac Aliphatic | -1.782 |
| Frac Aromatic | +1.281 |
| R/K Ratio | +0.294 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | +0.386 |
| FCR | -0.367 |
| NCPR | -0.154 |
| Hydrophobicity | -0.986 |
| Disorder Promoting | +0.082 |
| Iso point | -0.675 |
| PPII | +0.949 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +2.054 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |