FREM2 FREM2
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 28
Residues 655–685 · 30 aa
(0.9% of protein) · Min inter-cluster distance: 10.432
High aromatic fraction, specifically Ys
Sequence
RHSGPHSPGPVTDQFTFRVQDNHDPPNQSG
Top exceptional features (|z-score| rank)
Frac F: +2.96Frac H: +2.81E/D Ratio: -2.41Frac Aliphatic: -2.27Frac L: -1.68Frac Polar: +1.48Frac A: -1.42Frac Aromatic: +1.36
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.009 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.011 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.787 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | +1.173 |
| Frac E | -1.354 |
| Frac F | +2.963 |
| Frac G | +0.270 |
| Frac H | +2.810 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | -1.681 |
| Frac M | -0.832 |
| Frac N | +1.149 |
| Frac P | +0.760 |
| Frac Q | +1.007 |
| Frac R | +0.018 |
| Frac S | -0.375 |
| Frac T | +0.212 |
| Frac V | +1.125 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.795 |
| Frac D+E | -0.476 |
| Frac Polar | +1.482 |
| Frac Aliphatic | -2.273 |
| Frac Aromatic | +1.361 |
| R/K Ratio | +1.025 |
| E/D Ratio | -2.411 |
| Frac Chain Expanding | -0.484 |
| FCR | -0.879 |
| NCPR | -0.163 |
| Hydrophobicity | -0.945 |
| Disorder Promoting | -0.034 |
| Iso point | -0.204 |
| PPII | +0.087 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 25
Residues 3032–3063 · 31 aa
(1.0% of protein) · Min inter-cluster distance: 13.573
Blocks of positive residues
Sequence
EYHSLVSQGKPQSTTKSRKKREIRSTPSLAW
Top exceptional features (|z-score| rank)
hyd-pos: +2.66Frac W: +2.43NCPR: +1.53pol-pos: +1.39Frac K+R: +1.31Frac Y: +1.30Frac Aromatic: +1.28Frac D: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.433 |
| pol-hyd | +0.599 |
| pol-pos | +1.391 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.340 |
| hyd-pos | +2.660 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.666 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.829 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.384 |
| Frac F | -0.807 |
| Frac G | -0.826 |
| Frac H | +0.331 |
| Frac I | +0.726 |
| Frac K | +1.209 |
| Frac L | +0.167 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.689 |
| Frac Q | +0.222 |
| Frac R | +0.615 |
| Frac S | +1.027 |
| Frac T | +0.887 |
| Frac V | -0.132 |
| Frac W | +2.427 |
| Frac Y | +1.302 |
| Frac K+R | +1.310 |
| Frac D+E | -0.885 |
| Frac Polar | +0.361 |
| Frac Aliphatic | -0.729 |
| Frac Aromatic | +1.281 |
| R/K Ratio | -0.369 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.267 |
| FCR | +0.192 |
| NCPR | +1.531 |
| Hydrophobicity | -0.505 |
| Disorder Promoting | +0.082 |
| Iso point | +1.208 |
| PPII | -0.266 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 16
Residues 3139–3169 · 30 aa
(0.9% of protein) · Min inter-cluster distance: 2.04
Blocks of polar residues
Sequence
SFRGKDAPKGSSSSEPMVPPQSHHNDSSEV
Top exceptional features (|z-score| rank)
pol-pol: +3.63pol-pro: +2.54Frac S: +2.12Frac L: -1.68Frac H: +1.59Frac T: -1.28Frac Aliphatic: -1.19Frac V: +1.12
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +3.626 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.727 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.540 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.556 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.793 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.552 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.809 |
| Frac C | -0.582 |
| Frac D | +0.370 |
| Frac E | -0.352 |
| Frac F | +1.078 |
| Frac G | -0.269 |
| Frac H | +1.590 |
| Frac I | -0.900 |
| Frac K | +0.101 |
| Frac L | -1.681 |
| Frac M | +0.883 |
| Frac N | +0.080 |
| Frac P | +0.287 |
| Frac Q | -0.469 |
| Frac R | -0.643 |
| Frac S | +2.123 |
| Frac T | -1.284 |
| Frac V | +1.125 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.354 |
| Frac D+E | -0.092 |
| Frac Polar | +0.826 |
| Frac Aliphatic | -1.185 |
| Frac Aromatic | +0.119 |
| R/K Ratio | -0.561 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -0.147 |
| FCR | -0.301 |
| NCPR | -0.163 |
| Hydrophobicity | -0.419 |
| Disorder Promoting | +0.564 |
| Iso point | -0.271 |
| PPII | -0.093 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.025 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |