GATA3 GATA3
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 10
Residues 0–35 · 35 aa
(7.9% of protein) · Min inter-cluster distance: 5.981
Well-mixed hydrophobics, enriched in M
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSY
Top exceptional features (|z-score| rank)
Frac H: +6.47Frac W: +2.09pro-pro: -1.86Frac V: +1.82Frac Chain Expanding: -1.54FCR: -1.33Frac K+R: -1.30pol-pro: -1.15
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.824 |
| pol-hyd | -0.126 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.154 |
| pol-gly | +0.000 |
| hyd-hyd | +0.055 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.381 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.862 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.372 |
| Frac C | -0.582 |
| Frac D | +0.141 |
| Frac E | -0.924 |
| Frac F | -0.807 |
| Frac G | -0.423 |
| Frac H | +6.469 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | -0.044 |
| Frac M | +0.638 |
| Frac N | -0.073 |
| Frac P | +0.017 |
| Frac Q | +0.058 |
| Frac R | -0.738 |
| Frac S | -0.589 |
| Frac T | -0.002 |
| Frac V | +1.821 |
| Frac W | +2.091 |
| Frac Y | +1.083 |
| Frac K+R | -1.299 |
| Frac D+E | -0.641 |
| Frac Polar | +1.014 |
| Frac Aliphatic | +0.368 |
| Frac Aromatic | +1.006 |
| R/K Ratio | +0.598 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | -1.544 |
| FCR | -1.332 |
| NCPR | -0.370 |
| Hydrophobicity | +0.170 |
| Disorder Promoting | -1.061 |
| Iso point | -0.170 |
| PPII | -0.684 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 103–225 · 122 aa
(27.5% of protein) · Min inter-cluster distance: 6.085
S patches
Sequence
GSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPY
Top exceptional features (|z-score| rank)
Frac H: +1.85Frac Y: +1.33FCR: -1.33Frac Aromatic: +1.32Frac S: +1.32Frac Chain Expanding: -1.12hyd-hyd: -1.03Hydrophobicity: +1.01
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.623 |
| pol-hyd | -0.243 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.631 |
| pol-gly | +0.000 |
| hyd-hyd | -1.035 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.535 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.676 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.368 |
| Frac C | -0.023 |
| Frac D | -0.445 |
| Frac E | -0.984 |
| Frac F | +0.584 |
| Frac G | -0.022 |
| Frac H | +1.850 |
| Frac I | -0.074 |
| Frac K | -0.355 |
| Frac L | +0.432 |
| Frac M | +0.012 |
| Frac N | -0.726 |
| Frac P | +0.605 |
| Frac Q | -0.844 |
| Frac R | -0.979 |
| Frac S | +1.320 |
| Frac T | +0.371 |
| Frac V | -0.413 |
| Frac W | +0.238 |
| Frac Y | +1.333 |
| Frac K+R | -0.918 |
| Frac D+E | -0.967 |
| Frac Polar | +0.912 |
| Frac Aliphatic | -0.285 |
| Frac Aromatic | +1.321 |
| R/K Ratio | -0.864 |
| E/D Ratio | -0.862 |
| Frac Chain Expanding | -1.120 |
| FCR | -1.328 |
| NCPR | +0.127 |
| Hydrophobicity | +1.007 |
| Disorder Promoting | -0.270 |
| Iso point | +0.132 |
| PPII | -0.228 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.007 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.723 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 25
Residues 232–264 · 32 aa
(7.2% of protein) · Min inter-cluster distance: 1.516
Blocks of positive residues
Sequence
LFPPSSLLGGSPTGFGCKSRPKARSSTGRECV
Top exceptional features (|z-score| rank)
Frac C: +3.68Frac F: +2.73hyd-pos: +2.16pos-gly: +1.87hyd-hyd: +1.68Hydrophobicity: +1.61Frac D+E: -1.27Frac D: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.181 |
| pol-hyd | +0.384 |
| pol-pos | -0.444 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.164 |
| pol-gly | -0.940 |
| hyd-hyd | +1.681 |
| hyd-pos | +2.163 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.167 |
| hyd-gly | +0.084 |
| pos-pos | +0.961 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.283 |
| pos-gly | +1.874 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.089 |
| pro-gly | +0.696 |
| gly-gly | +0.584 |
| Frac A | -0.847 |
| Frac C | +3.680 |
| Frac D | -1.234 |
| Frac E | -0.884 |
| Frac F | +2.728 |
| Frac G | +1.179 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +0.027 |
| Frac L | +1.005 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.169 |
| Frac Q | -1.207 |
| Frac R | +0.555 |
| Frac S | +0.936 |
| Frac T | +0.118 |
| Frac V | -0.169 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.390 |
| Frac D+E | -1.267 |
| Frac Polar | +0.847 |
| Frac Aliphatic | -0.812 |
| Frac Aromatic | +1.206 |
| R/K Ratio | +0.170 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.695 |
| FCR | -0.698 |
| NCPR | +1.215 |
| Hydrophobicity | +1.606 |
| Disorder Promoting | -0.933 |
| Iso point | +1.208 |
| PPII | -0.785 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 23
Residues 355–394 · 39 aa
(8.8% of protein) · Min inter-cluster distance: 17.494
K blocks
Sequence
MKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPA
Top exceptional features (|z-score| rank)
K Patch: +3.31Frac K: +3.02Frac F: +2.09Frac K+R: +2.05pos-neg: +2.00Frac M: +1.81NCPR: +1.69Disorder Promoting: -1.51
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.148 |
| pol-hyd | +0.177 |
| pol-pos | -0.198 |
| pol-neg | +1.264 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.208 |
| hyd-pos | +0.255 |
| hyd-neg | -1.387 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.055 |
| pos-neg | +2.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.229 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.950 |
| Frac C | +1.166 |
| Frac D | +0.000 |
| Frac E | -0.583 |
| Frac F | +2.093 |
| Frac G | -0.933 |
| Frac H | +0.089 |
| Frac I | +0.392 |
| Frac K | +3.016 |
| Frac L | -0.946 |
| Frac M | +1.807 |
| Frac N | +1.478 |
| Frac P | -0.876 |
| Frac Q | -0.639 |
| Frac R | -0.287 |
| Frac S | +0.432 |
| Frac T | -0.709 |
| Frac V | -0.374 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +2.054 |
| Frac D+E | -0.447 |
| Frac Polar | -0.233 |
| Frac Aliphatic | -0.851 |
| Frac Aromatic | +0.788 |
| R/K Ratio | -1.403 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.553 |
| FCR | +1.009 |
| NCPR | +1.690 |
| Hydrophobicity | -0.884 |
| Disorder Promoting | -1.508 |
| Iso point | +0.872 |
| PPII | -0.215 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +3.305 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 6
Residues 395–443 · 48 aa
(10.8% of protein) · Min inter-cluster distance: 1.046
S patches
Sequence
LSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG
Top exceptional features (|z-score| rank)
Frac M: +4.53Frac H: +4.49S Patch: +2.58Frac S: +2.19Frac Chain Expanding: -2.17FCR: -2.14Iso point: +1.88Hydrophobicity: +1.87
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.780 |
| pol-hyd | -0.489 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.099 |
| pol-gly | +0.000 |
| hyd-hyd | -0.053 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.365 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.789 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.038 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -1.354 |
| Frac F | +1.549 |
| Frac G | -0.674 |
| Frac H | +4.487 |
| Frac I | +0.150 |
| Frac K | -1.083 |
| Frac L | +0.706 |
| Frac M | +4.528 |
| Frac N | -0.989 |
| Frac P | +0.465 |
| Frac Q | -1.207 |
| Frac R | -0.891 |
| Frac S | +2.185 |
| Frac T | +0.586 |
| Frac V | -0.550 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.401 |
| Frac D+E | -1.627 |
| Frac Polar | +1.564 |
| Frac Aliphatic | +0.718 |
| Frac Aromatic | +0.430 |
| R/K Ratio | +0.598 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -2.170 |
| FCR | -2.142 |
| NCPR | +0.309 |
| Hydrophobicity | +1.870 |
| Disorder Promoting | -1.307 |
| Iso point | +1.881 |
| PPII | -0.744 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.168 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.579 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |