GRIP1 GRIP1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 9
Residues 751–799 · 48 aa
(4.3% of protein) · Min inter-cluster distance: 3.364
Blocks of positive & negative residues
Sequence
KKQTDAQSASSPKKFPISSHLSDLGDVEEDSSPAQKPGKLSDMYPSTV
Top exceptional features (|z-score| rank)
pos-neg: +2.56neg-pro: +2.38R/K Ratio: -2.19pos-pro: -1.65pos-pos: +1.59E/D Ratio: -1.49Frac R: -1.30pol-pos: +1.27
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.608 |
| pol-hyd | +0.233 |
| pol-pos | +1.274 |
| pol-neg | +1.094 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.068 |
| pol-gly | +0.000 |
| hyd-hyd | +0.254 |
| hyd-pos | +0.559 |
| hyd-neg | -0.773 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.252 |
| hyd-gly | +0.000 |
| pos-pos | +1.592 |
| pos-neg | +2.564 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -1.652 |
| pos-gly | +0.000 |
| neg-neg | +0.679 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +2.375 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.782 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.274 |
| Frac C | -0.582 |
| Frac D | +1.273 |
| Frac E | -0.728 |
| Frac F | +0.371 |
| Frac G | -0.674 |
| Frac H | -0.087 |
| Frac I | +0.150 |
| Frac K | +1.137 |
| Frac L | +0.109 |
| Frac M | +0.240 |
| Frac N | -0.989 |
| Frac P | -0.126 |
| Frac Q | +0.177 |
| Frac R | -1.304 |
| Frac S | +1.248 |
| Frac T | -0.349 |
| Frac V | +0.211 |
| Frac W | -0.508 |
| Frac Y | +0.625 |
| Frac K+R | -0.023 |
| Frac D+E | +0.051 |
| Frac Polar | -0.076 |
| Frac Aliphatic | +0.038 |
| Frac Aromatic | +0.430 |
| R/K Ratio | -2.185 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | -0.063 |
| FCR | +0.023 |
| NCPR | -0.054 |
| Hydrophobicity | +0.254 |
| Disorder Promoting | +0.190 |
| Iso point | -0.675 |
| PPII | +0.067 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 930–982 · 52 aa
(4.6% of protein) · Min inter-cluster distance: 1.807
S patches
Sequence
SGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSV
Top exceptional features (|z-score| rank)
Frac S: +1.58Frac Polar: +1.53Iso point: +1.48pol-pos: -1.21R/K Ratio: +1.19Frac Chain Expanding: -1.13Frac R: +0.98Frac D+E: -0.96
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.608 |
| pol-hyd | -0.317 |
| pol-pos | -1.208 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.081 |
| hyd-pos | -0.367 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.923 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.715 |
| Frac C | -0.582 |
| Frac D | -0.771 |
| Frac E | -0.776 |
| Frac F | +0.281 |
| Frac G | -0.415 |
| Frac H | +0.558 |
| Frac I | -0.900 |
| Frac K | -0.742 |
| Frac L | -0.028 |
| Frac M | +0.158 |
| Frac N | +0.245 |
| Frac P | -0.513 |
| Frac Q | +0.496 |
| Frac R | +0.984 |
| Frac S | +1.585 |
| Frac T | +0.873 |
| Frac V | +0.094 |
| Frac W | -0.508 |
| Frac Y | +0.530 |
| Frac K+R | +0.104 |
| Frac D+E | -0.963 |
| Frac Polar | +1.532 |
| Frac Aliphatic | -0.851 |
| Frac Aromatic | +0.310 |
| R/K Ratio | +1.188 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | -1.133 |
| FCR | -0.657 |
| NCPR | +0.797 |
| Hydrophobicity | -0.256 |
| Disorder Promoting | +0.104 |
| Iso point | +1.477 |
| PPII | -0.837 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 24
Residues 1089–1128 · 39 aa
(3.5% of protein) · Min inter-cluster distance: 0.986
Weak negative charge
Sequence
QKSIDQQSLPGDWSEQNSAFFQQPSHGGNLETREPTNTL
Top exceptional features (|z-score| rank)
Frac Q: +2.20Frac F: +2.09Frac W: +1.82Frac Aromatic: +1.74Frac Polar: +1.53Frac N: +1.48Frac V: -1.31Frac Aliphatic: -1.27
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.524 |
| pol-hyd | -0.885 |
| pol-pos | +0.000 |
| pol-neg | -1.125 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.035 |
| hyd-pos | +0.000 |
| hyd-neg | -0.824 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.572 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.950 |
| Frac C | -0.582 |
| Frac D | +0.000 |
| Frac E | -0.198 |
| Frac F | +2.093 |
| Frac G | -0.104 |
| Frac H | +0.089 |
| Frac I | +0.392 |
| Frac K | -0.628 |
| Frac L | +0.523 |
| Frac M | -0.832 |
| Frac N | +1.478 |
| Frac P | -0.513 |
| Frac Q | +2.200 |
| Frac R | -0.796 |
| Frac S | +0.048 |
| Frac T | +0.442 |
| Frac V | -1.311 |
| Frac W | +1.825 |
| Frac Y | -0.609 |
| Frac K+R | -0.998 |
| Frac D+E | -0.151 |
| Frac Polar | +1.532 |
| Frac Aliphatic | -1.269 |
| Frac Aromatic | +1.743 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | -1.262 |
| FCR | -0.768 |
| NCPR | -0.542 |
| Hydrophobicity | -0.440 |
| Disorder Promoting | -1.048 |
| Iso point | -1.011 |
| PPII | -0.618 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |