HNF1B HNF1B
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 13
Residues 41–90 · 49 aa
(8.8% of protein) · Min inter-cluster distance: 3.085
Blocks of negative, P, & polar residues
Sequence
KLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPP
Top exceptional features (|z-score| rank)
D Patch: +3.67hyd-neg: +2.60neg-neg: +2.15Frac D: +1.71neg-pro: +1.71pol-pol: -1.69pol-neg: +1.60pol-hyd: -1.47
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.694 |
| pol-hyd | -1.470 |
| pol-pos | +0.000 |
| pol-neg | +1.597 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.048 |
| pol-gly | -0.707 |
| hyd-hyd | +0.527 |
| hyd-pos | +0.000 |
| hyd-neg | +2.602 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.866 |
| hyd-gly | +0.959 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.150 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +1.706 |
| neg-gly | -0.252 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.312 |
| pro-gly | +0.546 |
| gly-gly | -0.129 |
| Frac A | -0.671 |
| Frac C | -0.582 |
| Frac D | +1.713 |
| Frac E | -0.127 |
| Frac F | +0.347 |
| Frac G | +0.963 |
| Frac H | +0.644 |
| Frac I | -0.900 |
| Frac K | +0.004 |
| Frac L | +1.242 |
| Frac M | -0.832 |
| Frac N | -0.335 |
| Frac P | +0.133 |
| Frac Q | -1.207 |
| Frac R | -0.900 |
| Frac S | -0.650 |
| Frac T | +1.006 |
| Frac V | -0.565 |
| Frac W | -0.508 |
| Frac Y | +0.600 |
| Frac K+R | -0.597 |
| Frac D+E | +0.722 |
| Frac Polar | +0.050 |
| Frac Aliphatic | -0.697 |
| Frac Aromatic | +0.398 |
| R/K Ratio | -0.864 |
| E/D Ratio | -1.013 |
| Frac Chain Expanding | +0.273 |
| FCR | +0.152 |
| NCPR | -0.939 |
| Hydrophobicity | +0.065 |
| Disorder Promoting | +0.259 |
| Iso point | -1.011 |
| PPII | -0.587 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +3.672 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 319–379 · 60 aa
(10.8% of protein) · Min inter-cluster distance: 6.28
S patches
Sequence
SNQTHSLNPLLSHGSPHHQPSSSPPNKLSGVRYSQQGNNEITSSSTISHHGNSAMVTSQS
Top exceptional features (|z-score| rank)
Frac Polar: +2.96Frac H: +2.81Frac Chain Expanding: -2.51Frac N: +2.22Frac S: +2.12FCR: -1.89Frac D+E: -1.44Frac K+R: -1.24
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.503 |
| pol-hyd | -0.394 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.124 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.115 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -1.103 |
| Frac F | -0.807 |
| Frac G | -0.269 |
| Frac H | +2.810 |
| Frac I | +0.780 |
| Frac K | -0.787 |
| Frac L | +0.229 |
| Frac M | +0.026 |
| Frac N | +2.219 |
| Frac P | -0.422 |
| Frac Q | +0.638 |
| Frac R | -0.974 |
| Frac S | +2.123 |
| Frac T | +0.212 |
| Frac V | -0.093 |
| Frac W | -0.508 |
| Frac Y | +0.378 |
| Frac K+R | -1.236 |
| Frac D+E | -1.435 |
| Frac Polar | +2.957 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | -0.502 |
| R/K Ratio | -0.133 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -2.507 |
| FCR | -1.889 |
| NCPR | +0.272 |
| Hydrophobicity | +0.202 |
| Disorder Promoting | -1.232 |
| Iso point | +0.805 |
| PPII | -1.138 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.649 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 10
Residues 380–410 · 30 aa
(5.4% of protein) · Min inter-cluster distance: 10.723
Well-mixed hydrophobics, enriched in M
Sequence
LQQVSPASLDPGHNLLSPDGKMISVSGGGL
Top exceptional features (|z-score| rank)
Frac L: +3.09Disorder Promoting: -2.43Hydrophobicity: +2.40Frac Aliphatic: +2.08E/D Ratio: -2.03Frac Chain Expanding: -1.83FCR: -1.46Frac E: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.747 |
| pol-hyd | -1.155 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.159 |
| hyd-hyd | -0.695 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | -0.314 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.448 |
| Frac A | -0.809 |
| Frac C | -0.582 |
| Frac D | +0.370 |
| Frac E | -1.354 |
| Frac F | -0.807 |
| Frac G | +1.348 |
| Frac H | +0.370 |
| Frac I | +0.780 |
| Frac K | -0.491 |
| Frac L | +3.093 |
| Frac M | +0.883 |
| Frac N | +0.080 |
| Frac P | -0.185 |
| Frac Q | +0.269 |
| Frac R | -1.304 |
| Frac S | +0.624 |
| Frac T | -1.284 |
| Frac V | +1.125 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.236 |
| Frac D+E | -0.860 |
| Frac Polar | +0.826 |
| Frac Aliphatic | +2.078 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | -2.028 |
| Frac Chain Expanding | -1.833 |
| FCR | -1.456 |
| NCPR | -0.163 |
| Hydrophobicity | +2.401 |
| Disorder Promoting | -2.430 |
| Iso point | -0.675 |
| PPII | -1.031 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |