INF2 INF2
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 19
Residues 0–31 · 31 aa
(2.5% of protein) · Min inter-cluster distance: 2.155
High negative fraction, specifically Es
Sequence
MSVKEGAQRKWAALKEKLGPQDSDPTEANLE
Top exceptional features (|z-score| rank)
Frac W: +2.43pol-neg: -1.41Frac Aliphatic: +1.38Frac Polar: -1.23Frac K: +1.21R/K Ratio: -1.10Frac L: +1.09pos-ala: -1.00
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.245 |
| pol-hyd | +0.237 |
| pol-pos | +0.843 |
| pol-neg | -1.408 |
| pol-aro | +0.000 |
| pol-ala | +0.366 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.295 |
| hyd-pos | -0.745 |
| hyd-neg | -0.520 |
| hyd-aro | +0.000 |
| hyd-ala | -0.490 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.277 |
| pos-neg | +0.579 |
| pos-aro | +0.000 |
| pos-ala | -0.998 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.529 |
| neg-aro | +0.000 |
| neg-ala | +0.125 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.115 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.947 |
| Frac C | -0.582 |
| Frac D | +0.319 |
| Frac E | +0.585 |
| Frac F | -0.807 |
| Frac G | -0.304 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +1.209 |
| Frac L | +1.091 |
| Frac M | +0.828 |
| Frac N | +0.046 |
| Frac P | -0.689 |
| Frac Q | +0.222 |
| Frac R | -0.665 |
| Frac S | -0.907 |
| Frac T | -0.560 |
| Frac V | -0.132 |
| Frac W | +2.427 |
| Frac Y | -0.609 |
| Frac K+R | +0.457 |
| Frac D+E | +0.601 |
| Frac Polar | -1.226 |
| Frac Aliphatic | +1.376 |
| Frac Aromatic | +0.079 |
| R/K Ratio | -1.100 |
| E/D Ratio | +0.116 |
| Frac Chain Expanding | +0.386 |
| FCR | +0.751 |
| NCPR | -0.154 |
| Hydrophobicity | -0.024 |
| Disorder Promoting | -0.498 |
| Iso point | -0.809 |
| PPII | -0.033 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 1
Residues 344–517 · 173 aa
(13.9% of protein) · Min inter-cluster distance: 30.743
Blocks of P & polar residues
Sequence
KGRPRPSPLVKAHKSVQANLDQSQRGSSPQNTTTPKPSVEGQQPAAAAACEPVDHAQSESILKVSQPRALEQQASTPPPPPPPPLLPGSSAEPPPPPPPPPLPSVGAKALPTAPPPPPLPGLGAMAPPAPPLPPPLPGSCEFLPPPPPPLPGLGCPPPPPPLLPGMGWGPPPP
Top exceptional features (|z-score| rank)
pol-pro: +7.88pro-pro: +7.56P Patch: +3.65Frac P: +3.40hyd-pro: +3.37PPII: +3.22pol-pol: +3.10pol-hyd: +2.19
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +3.098 |
| pol-hyd | +2.185 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +7.880 |
| pol-gly | +0.000 |
| hyd-hyd | -0.403 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +3.369 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +7.562 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.383 |
| Frac C | +0.600 |
| Frac D | -0.956 |
| Frac E | -0.833 |
| Frac F | -0.480 |
| Frac G | -0.132 |
| Frac H | -0.426 |
| Frac I | -0.609 |
| Frac K | -0.467 |
| Frac L | +1.134 |
| Frac M | -0.237 |
| Frac N | -0.618 |
| Frac P | +3.397 |
| Frac Q | +0.073 |
| Frac R | -0.846 |
| Frac S | -0.661 |
| Frac T | -0.635 |
| Frac V | -0.044 |
| Frac W | +0.018 |
| Frac Y | -0.609 |
| Frac K+R | -0.912 |
| Frac D+E | -1.095 |
| Frac Polar | -0.978 |
| Frac Aliphatic | +0.694 |
| Frac Aromatic | -0.692 |
| R/K Ratio | -0.488 |
| E/D Ratio | +0.564 |
| Frac Chain Expanding | +0.763 |
| FCR | -1.421 |
| NCPR | +0.228 |
| Hydrophobicity | +1.155 |
| Disorder Promoting | +0.132 |
| Iso point | +0.401 |
| PPII | +3.218 |
| A Patch | +0.313 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +3.650 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 23
Residues 926–968 · 42 aa
(3.4% of protein) · Min inter-cluster distance: 0.018
K blocks
Sequence
NKDRKEQAAKAERRKQQLAEEEARRPRGEDGKPVRKGPGKQE
Top exceptional features (|z-score| rank)
Frac K+R: +2.73Hydrophobicity: -2.69FCR: +2.42Frac Chain Expanding: +2.41Disorder Promoting: +2.27Frac R: +2.00Frac K: +1.88Frac S: -1.87
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.809 |
| pol-hyd | +0.000 |
| pol-pos | +0.038 |
| pol-neg | +0.694 |
| pol-aro | +0.000 |
| pol-ala | +0.004 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.213 |
| pos-neg | +0.293 |
| pos-aro | +0.000 |
| pos-ala | -0.074 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.740 |
| neg-aro | +0.000 |
| neg-ala | -0.646 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.940 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.764 |
| Frac C | -0.582 |
| Frac D | -0.088 |
| Frac E | +1.151 |
| Frac F | -0.807 |
| Frac G | +0.193 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +1.877 |
| Frac L | -0.999 |
| Frac M | -0.832 |
| Frac N | -0.225 |
| Frac P | -0.591 |
| Frac Q | +0.902 |
| Frac R | +2.001 |
| Frac S | -1.874 |
| Frac T | -1.284 |
| Frac V | -0.441 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +2.733 |
| Frac D+E | +0.839 |
| Frac Polar | -1.656 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +0.742 |
| Frac Chain Expanding | +2.406 |
| FCR | +2.421 |
| NCPR | +1.163 |
| Hydrophobicity | -2.685 |
| Disorder Promoting | +2.275 |
| Iso point | +0.939 |
| PPII | +0.750 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 5
Residues 983–1249 · 266 aa
(21.3% of protein) · Min inter-cluster distance: 13.525
Blocks of positive, negative & P residues
Sequence
FQLRKTARGRGDTDGGSKAASMDPPRATEPVATSNPAGDPVGSTRCPASEPGLDATTASESRGWDLVDAVTPGPQPTLEQLEEGGPRPLERRSSWYVDASDVLTTEDPQCPQPLEGAWPVTLGDAQALKPLKFSSNQPPAAGSSRQDAKDPTSLLGVLQAEADSTSEGLEDAVHSRGARPPAAGPGGDEDEDEEDTAPESALDTSLDKSFSEDAVTDSSGSGTLPRARGRASKGTGKRRKKRPSRSQEEVPPDSDDNKTKKLCVIQ
Top exceptional features (|z-score| rank)
pos-neg: +5.80hyd-pos: +3.44pos-pro: +2.65neg-pro: +2.52pos-pos: +2.40pos-ala: +1.90pro-pro: +1.63neg-ala: +1.54
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.170 |
| pol-hyd | +0.019 |
| pol-pos | +0.996 |
| pol-neg | +0.649 |
| pol-aro | +0.000 |
| pol-ala | -0.431 |
| pol-pro | -0.173 |
| pol-gly | +0.000 |
| hyd-hyd | -0.069 |
| hyd-pos | +3.443 |
| hyd-neg | +1.051 |
| hyd-aro | +0.000 |
| hyd-ala | +0.125 |
| hyd-pro | +0.690 |
| hyd-gly | +0.000 |
| pos-pos | +2.400 |
| pos-neg | +5.799 |
| pos-aro | +0.000 |
| pos-ala | +1.895 |
| pos-pro | +2.652 |
| pos-gly | +0.000 |
| neg-neg | +1.232 |
| neg-aro | +0.000 |
| neg-ala | +1.544 |
| neg-pro | +2.516 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -0.163 |
| ala-pro | -0.741 |
| ala-gly | +0.000 |
| pro-pro | +1.629 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.511 |
| Frac C | +0.187 |
| Frac D | +1.119 |
| Frac E | -0.224 |
| Frac F | -0.169 |
| Frac G | +0.172 |
| Frac H | -0.712 |
| Frac I | -0.711 |
| Frac K | -0.215 |
| Frac L | +0.365 |
| Frac M | -0.638 |
| Frac N | -0.627 |
| Frac P | -0.111 |
| Frac Q | -0.291 |
| Frac R | +0.112 |
| Frac S | -0.240 |
| Frac T | +0.403 |
| Frac V | +0.337 |
| Frac W | +0.518 |
| Frac Y | -0.386 |
| Frac K+R | -0.085 |
| Frac D+E | +0.363 |
| Frac Polar | -0.362 |
| Frac Aliphatic | +0.381 |
| Frac Aromatic | -0.142 |
| R/K Ratio | +0.243 |
| E/D Ratio | -0.899 |
| Frac Chain Expanding | +0.175 |
| FCR | +0.217 |
| NCPR | -0.331 |
| Hydrophobicity | +0.326 |
| Disorder Promoting | +0.452 |
| Iso point | -0.944 |
| PPII | -0.220 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +0.768 |
| E Patch | -0.022 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +0.456 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | +0.097 |