INVS INVS
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 17
Residues 579–834 · 255 aa
(23.9% of protein) · Min inter-cluster distance: 5.056
Weak positive charge
Sequence
NLLMKHEQLRKDAAAKKREEENKRKEAEQQKGRRSPDSCRPQALPCLPSTQDVPSRQSRAPSKQPPAGNVAQGPEPRDSRGSPGGSLGGALQKEQHVSSDLQGTNSRRPNETAREHSKGQSACVHFRPNEGSDGSRHPGVPSVEKSRGETAGDERCAKGKGFVKQPSCIRVAGPDEKGEDSRRAAASLPPHDSHWKPSRRHDTEPKAKCAPQKRRTQELRGGRCSPAGSSRPGSARGEAVHAGQNPPHHRTPRNK
Top exceptional features (|z-score| rank)
pol-pro: -2.52pos-neg: -1.68pol-pol: -1.32Frac C: +1.29pol-pos: -1.09Frac R: +1.03neg-pro: +0.98Frac K+R: +0.92
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.317 |
| pol-hyd | +0.000 |
| pol-pos | -1.092 |
| pol-neg | -0.900 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -2.525 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.593 |
| pos-neg | -1.682 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.162 |
| pos-gly | +0.000 |
| neg-neg | +0.383 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.976 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.375 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.235 |
| Frac C | +1.290 |
| Frac D | -0.196 |
| Frac E | -0.234 |
| Frac F | -0.364 |
| Frac G | +0.238 |
| Frac H | +0.729 |
| Frac I | -0.703 |
| Frac K | +0.310 |
| Frac L | -0.558 |
| Frac M | -0.630 |
| Frac N | +0.017 |
| Frac P | -0.102 |
| Frac Q | +0.182 |
| Frac R | +1.029 |
| Frac S | -0.287 |
| Frac T | -0.668 |
| Frac V | -0.021 |
| Frac W | -0.151 |
| Frac Y | -0.609 |
| Frac K+R | +0.917 |
| Frac D+E | -0.273 |
| Frac Polar | +0.132 |
| Frac Aliphatic | -0.546 |
| Frac Aromatic | -0.684 |
| R/K Ratio | +0.277 |
| E/D Ratio | +0.116 |
| Frac Chain Expanding | +0.389 |
| FCR | +0.395 |
| NCPR | +0.810 |
| Hydrophobicity | -0.803 |
| Disorder Promoting | +0.811 |
| Iso point | +0.872 |
| PPII | +0.005 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +0.132 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 24
Residues 840–886 · 46 aa
(4.3% of protein) · Min inter-cluster distance: 7.11
Weak negative charge
Sequence
TGGLYSHLPQSTEELRSGARRLETSTLSEDFQVSKETDPAPGPLSG
Top exceptional features (|z-score| rank)
hyd-hyd: -2.46Frac L: +2.06pol-hyd: -1.64neg-gly: +1.50Frac T: +1.16hyd-gly: -1.07Frac N: -0.99pol-gly: +0.95
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.075 |
| pol-hyd | -1.636 |
| pol-pos | +0.000 |
| pol-neg | -0.767 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.953 |
| hyd-hyd | -2.459 |
| hyd-pos | +0.000 |
| hyd-neg | -0.534 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | -1.075 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.798 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +1.500 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.530 |
| Frac A | -0.623 |
| Frac C | -0.582 |
| Frac D | -0.188 |
| Frac E | +0.280 |
| Frac F | +0.422 |
| Frac G | +0.410 |
| Frac H | -0.054 |
| Frac I | -0.900 |
| Frac K | -0.697 |
| Frac L | +2.056 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.370 |
| Frac Q | -0.244 |
| Frac R | -0.011 |
| Frac S | +0.407 |
| Frac T | +1.155 |
| Frac V | -0.517 |
| Frac W | -0.508 |
| Frac Y | +0.679 |
| Frac K+R | -0.527 |
| Frac D+E | +0.124 |
| Frac Polar | +0.513 |
| Frac Aliphatic | -0.169 |
| Frac Aromatic | +0.497 |
| R/K Ratio | +0.598 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.557 |
| FCR | -0.251 |
| NCPR | -0.441 |
| Hydrophobicity | +0.600 |
| Disorder Promoting | +0.044 |
| Iso point | -0.944 |
| PPII | -0.911 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |