ITGB4 ITB4
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 20
Residues 1106–1141 · 35 aa
(1.9% of protein) · Min inter-cluster distance: 3.028
A blocks
Sequence
ELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGSR
Top exceptional features (|z-score| rank)
ala-pro: +2.45hyd-pro: +2.43hyd-ala: +2.08pol-ala: +1.49Frac V: -1.31ala-ala: +1.28pro-pro: +1.20E/D Ratio: -1.10
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.097 |
| pol-hyd | +0.036 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +1.486 |
| pol-pro | +0.281 |
| pol-gly | +0.000 |
| hyd-hyd | +0.750 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +2.078 |
| hyd-pro | +2.427 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +1.284 |
| ala-pro | +2.454 |
| ala-gly | +0.000 |
| pro-pro | +1.203 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.677 |
| Frac C | -0.582 |
| Frac D | +0.141 |
| Frac E | -0.924 |
| Frac F | +0.809 |
| Frac G | +0.039 |
| Frac H | +0.196 |
| Frac I | -0.900 |
| Frac K | -0.576 |
| Frac L | +0.774 |
| Frac M | +0.638 |
| Frac N | +0.844 |
| Frac P | +0.422 |
| Frac Q | +0.691 |
| Frac R | -0.171 |
| Frac S | +0.267 |
| Frac T | -0.643 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.543 |
| Frac D+E | -0.641 |
| Frac Polar | +0.451 |
| Frac Aliphatic | +0.368 |
| Frac Aromatic | -0.058 |
| R/K Ratio | +0.294 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | -0.677 |
| FCR | -0.837 |
| NCPR | +0.127 |
| Hydrophobicity | +0.214 |
| Disorder Promoting | -0.034 |
| Iso point | +0.401 |
| PPII | +0.091 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 0
Residues 1395–1448 · 53 aa
(2.9% of protein) · Min inter-cluster distance: 2.622
Blocks of G & polar residues
Sequence
LIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMD
Top exceptional features (|z-score| rank)
Frac G: +2.01hyd-gly: +1.91hyd-hyd: +1.73pol-gly: +1.45G Patch: +1.41hyd-pro: +1.32E/D Ratio: -1.25neg-neg: +1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.307 |
| pol-hyd | +0.104 |
| pol-pos | +0.000 |
| pol-neg | +1.046 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.889 |
| pol-gly | +1.447 |
| hyd-hyd | +1.726 |
| hyd-pos | +0.000 |
| hyd-neg | +0.930 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.321 |
| hyd-gly | +1.906 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.229 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.356 |
| neg-gly | +1.169 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.013 |
| pro-gly | +0.903 |
| gly-gly | -0.052 |
| Frac A | +0.311 |
| Frac C | -0.582 |
| Frac D | +0.582 |
| Frac E | -0.787 |
| Frac F | -0.807 |
| Frac G | +2.009 |
| Frac H | +0.531 |
| Frac I | +0.051 |
| Frac K | -0.748 |
| Frac L | +0.481 |
| Frac M | +0.139 |
| Frac N | -0.384 |
| Frac P | +0.537 |
| Frac Q | -1.207 |
| Frac R | +0.192 |
| Frac S | +0.106 |
| Frac T | -0.860 |
| Frac V | -0.622 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.429 |
| Frac D+E | -0.324 |
| Frac Polar | +0.319 |
| Frac Aliphatic | +0.333 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.833 |
| E/D Ratio | -1.245 |
| Frac Chain Expanding | -0.230 |
| FCR | -0.525 |
| NCPR | -0.037 |
| Hydrophobicity | +0.670 |
| Disorder Promoting | +0.847 |
| Iso point | -0.271 |
| PPII | -0.495 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +1.412 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.224 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 6
Residues 1492–1525 · 33 aa
(1.8% of protein) · Min inter-cluster distance: 16.517
S patches
Sequence
NSLTRSEHSHSTTLPRDYSTLTSVSSHDSRLTA
Top exceptional features (|z-score| rank)
Frac T: +2.79Frac H: +2.48Frac S: +2.21PPII: -2.05S Patch: +1.92Frac Polar: +1.90Frac L: +1.79Frac Chain Expanding: -1.71
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.726 |
| pol-hyd | -0.269 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.037 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.864 |
| Frac C | -0.582 |
| Frac D | +0.225 |
| Frac E | -0.898 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | +2.477 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +1.791 |
| Frac M | -0.832 |
| Frac N | -0.017 |
| Frac P | -1.174 |
| Frac Q | -1.207 |
| Frac R | +0.498 |
| Frac S | +2.214 |
| Frac T | +2.795 |
| Frac V | -0.204 |
| Frac W | -0.508 |
| Frac Y | +1.186 |
| Frac K+R | -0.474 |
| Frac D+E | -0.581 |
| Frac Polar | +1.899 |
| Frac Aliphatic | -0.394 |
| Frac Aromatic | +0.006 |
| R/K Ratio | +1.328 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | -1.710 |
| FCR | -0.748 |
| NCPR | +0.127 |
| Hydrophobicity | +0.381 |
| Disorder Promoting | -0.252 |
| Iso point | +0.401 |
| PPII | -2.049 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.916 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |