KANK1 KANK1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 4
Residues 0–31 · 31 aa
(2.3% of protein) · Min inter-cluster distance: 3.608
Weak negative charge, high N fraction
Sequence
MAHTTKVNGSASGKAGDILSGDQDKEQKDPY
Top exceptional features (|z-score| rank)
Frac D: +1.87R/K Ratio: -1.83E/D Ratio: -1.78Frac R: -1.30Frac Y: +1.30Frac K: +1.21Frac P: -1.15PPII: -1.02
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.505 |
| pol-hyd | -0.347 |
| pol-pos | -0.577 |
| pol-neg | +0.818 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -0.097 |
| hyd-hyd | +0.795 |
| hyd-pos | +0.675 |
| hyd-neg | +0.662 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | -0.585 |
| pos-pos | -0.955 |
| pos-neg | -0.889 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | -0.067 |
| neg-neg | +0.878 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.593 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -0.646 |
| Frac A | +0.355 |
| Frac C | -0.582 |
| Frac D | +1.872 |
| Frac E | -0.869 |
| Frac F | -0.807 |
| Frac G | +0.739 |
| Frac H | +0.331 |
| Frac I | +0.726 |
| Frac K | +1.209 |
| Frac L | -0.757 |
| Frac M | +0.828 |
| Frac N | +0.046 |
| Frac P | -1.146 |
| Frac Q | +0.222 |
| Frac R | -1.304 |
| Frac S | -0.423 |
| Frac T | +0.164 |
| Frac V | -0.132 |
| Frac W | -0.508 |
| Frac Y | +1.302 |
| Frac K+R | +0.030 |
| Frac D+E | +0.229 |
| Frac Polar | +0.361 |
| Frac Aliphatic | +0.323 |
| Frac Aromatic | +0.079 |
| R/K Ratio | -1.831 |
| E/D Ratio | -1.785 |
| Frac Chain Expanding | -0.593 |
| FCR | +0.192 |
| NCPR | -0.154 |
| Hydrophobicity | -0.109 |
| Disorder Promoting | +0.082 |
| Iso point | -0.675 |
| PPII | -1.020 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 59–107 · 48 aa
(3.6% of protein) · Min inter-cluster distance: 1.322
S patches
Sequence
RLNIQKRRKPSVPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFL
Top exceptional features (|z-score| rank)
Frac C: +2.26S Patch: +1.87pol-pos: +1.70Frac N: +1.68Disorder Promoting: -1.68pro-pro: +1.66Frac A: -1.42P Patch: +1.40
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.069 |
| pol-hyd | +0.540 |
| pol-pos | +1.701 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.083 |
| pol-gly | +0.000 |
| hyd-hyd | -0.385 |
| hyd-pos | +0.831 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.028 |
| hyd-gly | +0.000 |
| pos-pos | +0.776 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.838 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.664 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | +2.259 |
| Frac D | -0.231 |
| Frac E | -0.728 |
| Frac F | +0.371 |
| Frac G | -0.674 |
| Frac H | -0.849 |
| Frac I | +1.201 |
| Frac K | +0.027 |
| Frac L | +0.109 |
| Frac M | -0.832 |
| Frac N | +1.684 |
| Frac P | -0.126 |
| Frac Q | +0.638 |
| Frac R | +0.348 |
| Frac S | +0.624 |
| Frac T | +0.586 |
| Frac V | -0.550 |
| Frac W | +1.388 |
| Frac Y | -0.609 |
| Frac K+R | +0.252 |
| Frac D+E | -0.668 |
| Frac Polar | +1.154 |
| Frac Aliphatic | -1.321 |
| Frac Aromatic | +0.430 |
| R/K Ratio | +0.102 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -0.484 |
| FCR | -0.337 |
| NCPR | +0.671 |
| Hydrophobicity | -0.271 |
| Disorder Promoting | -1.681 |
| Iso point | +0.670 |
| PPII | -0.131 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.399 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.873 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 17
Residues 111–188 · 77 aa
(5.7% of protein) · Min inter-cluster distance: 2.026
Weak positive charge
Sequence
QVTSTPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFG
Top exceptional features (|z-score| rank)
pol-hyd: -2.45hyd-hyd: -2.08E/D Ratio: +2.03pos-pro: +1.78Frac L: +1.67Iso point: +1.41Frac F: +1.40Disorder Promoting: -1.34
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.443 |
| pol-hyd | -2.450 |
| pol-pos | +0.318 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.285 |
| pol-gly | +0.000 |
| hyd-hyd | -2.085 |
| hyd-pos | -0.352 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.118 |
| hyd-gly | +0.000 |
| pos-pos | -0.093 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +1.777 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.314 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.944 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.183 |
| Frac F | +1.396 |
| Frac G | -0.927 |
| Frac H | +0.101 |
| Frac I | +0.409 |
| Frac K | -0.391 |
| Frac L | +1.667 |
| Frac M | +1.173 |
| Frac N | -0.156 |
| Frac P | +0.975 |
| Frac Q | +0.231 |
| Frac R | +0.756 |
| Frac S | -0.901 |
| Frac T | +1.339 |
| Frac V | -0.362 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.213 |
| Frac D+E | -0.730 |
| Frac Polar | -0.571 |
| Frac Aliphatic | +0.453 |
| Frac Aromatic | +0.329 |
| R/K Ratio | +0.722 |
| E/D Ratio | +2.027 |
| Frac Chain Expanding | +0.216 |
| FCR | -0.410 |
| NCPR | +0.692 |
| Hydrophobicity | +0.571 |
| Disorder Promoting | -1.341 |
| Iso point | +1.410 |
| PPII | +1.095 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.279 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 28
Residues 194–229 · 35 aa
(2.6% of protein) · Min inter-cluster distance: 18.404
High aromatic fraction, specifically Ys
Sequence
SLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAA
Top exceptional features (|z-score| rank)
Frac Y: +4.47Frac Aromatic: +3.14Frac N: +2.68G Patch: +2.59Frac Chain Expanding: -2.41Disorder Promoting: -2.09FCR: -1.83ala-gly: +1.74
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.678 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.512 |
| pol-ala | +0.846 |
| pol-pro | +0.000 |
| pol-gly | -0.528 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | -0.799 |
| aro-ala | -0.503 |
| aro-pro | +0.000 |
| aro-gly | -1.099 |
| ala-ala | +0.650 |
| ala-pro | +0.000 |
| ala-gly | +1.737 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.454 |
| Frac A | +0.677 |
| Frac C | -0.582 |
| Frac D | -0.547 |
| Frac E | -1.354 |
| Frac F | +0.809 |
| Frac G | +1.425 |
| Frac H | +1.241 |
| Frac I | -0.900 |
| Frac K | -0.576 |
| Frac L | -0.044 |
| Frac M | -0.832 |
| Frac N | +2.677 |
| Frac P | -0.388 |
| Frac Q | +0.691 |
| Frac R | -1.304 |
| Frac S | -0.161 |
| Frac T | -1.284 |
| Frac V | -0.267 |
| Frac W | -0.508 |
| Frac Y | +4.467 |
| Frac K+R | -1.299 |
| Frac D+E | -1.298 |
| Frac Polar | +1.576 |
| Frac Aliphatic | -0.098 |
| Frac Aromatic | +3.136 |
| R/K Ratio | -0.864 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | -2.411 |
| FCR | -1.827 |
| NCPR | +0.127 |
| Hydrophobicity | +0.458 |
| Disorder Promoting | -2.087 |
| Iso point | +0.132 |
| PPII | -1.311 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +2.588 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 6
Residues 913–946 · 33 aa
(2.4% of protein) · Min inter-cluster distance: 11.161
S patches
Sequence
SGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQ
Top exceptional features (|z-score| rank)
S Patch: +2.94Frac S: +1.76Frac Polar: +1.60Frac Q: +1.48pro-pro: -1.47pol-pol: +1.41Frac R: -1.30Frac K+R: -1.28
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.414 |
| pol-hyd | +0.142 |
| pol-pos | +0.000 |
| pol-neg | +0.567 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.224 |
| pol-gly | +0.000 |
| hyd-hyd | -0.985 |
| hyd-pos | +0.000 |
| hyd-neg | -0.589 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.836 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.441 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.596 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.470 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.864 |
| Frac C | -0.582 |
| Frac D | -0.505 |
| Frac E | +0.012 |
| Frac F | +0.907 |
| Frac G | +0.123 |
| Frac H | -0.849 |
| Frac I | +0.628 |
| Frac K | -0.545 |
| Frac L | +0.055 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.115 |
| Frac Q | +1.477 |
| Frac R | -1.304 |
| Frac S | +1.759 |
| Frac T | +0.756 |
| Frac V | -0.204 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.276 |
| Frac D+E | -0.232 |
| Frac Polar | +1.601 |
| Frac Aliphatic | -0.889 |
| Frac Aromatic | +0.006 |
| R/K Ratio | -0.864 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -1.097 |
| FCR | -1.010 |
| NCPR | -0.664 |
| Hydrophobicity | +0.587 |
| Disorder Promoting | +0.837 |
| Iso point | -1.179 |
| PPII | -0.024 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.943 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 6
Cluster 18
Residues 974–1060 · 86 aa
(6.4% of protein) · Min inter-cluster distance: 14.314
Large negative blocks with positive blocks
Sequence
KSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKS
Top exceptional features (|z-score| rank)
pos-neg: +4.93hyd-neg: +3.95neg-neg: +2.82pol-pos: +2.32pol-hyd: +2.09hyd-hyd: +2.03pos-pos: +1.98pol-neg: +1.83
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.170 |
| pol-hyd | +2.091 |
| pol-pos | +2.316 |
| pol-neg | +1.829 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +2.032 |
| hyd-pos | +0.372 |
| hyd-neg | +3.946 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.979 |
| pos-neg | +4.926 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.821 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.780 |
| Frac C | +0.211 |
| Frac D | +1.565 |
| Frac E | +1.267 |
| Frac F | -0.149 |
| Frac G | +0.157 |
| Frac H | +0.002 |
| Frac I | +1.445 |
| Frac K | +0.569 |
| Frac L | -0.682 |
| Frac M | +0.365 |
| Frac N | +0.876 |
| Frac P | -1.439 |
| Frac Q | -0.950 |
| Frac R | -1.074 |
| Frac S | +0.392 |
| Frac T | -0.501 |
| Frac V | -0.036 |
| Frac W | -0.508 |
| Frac Y | +0.768 |
| Frac K+R | -0.292 |
| Frac D+E | +1.719 |
| Frac Polar | +0.010 |
| Frac Aliphatic | -0.515 |
| Frac Aromatic | +0.177 |
| R/K Ratio | -1.719 |
| E/D Ratio | -0.066 |
| Frac Chain Expanding | +0.261 |
| FCR | +1.102 |
| NCPR | -1.492 |
| Hydrophobicity | -0.519 |
| Disorder Promoting | -0.828 |
| Iso point | -1.078 |
| PPII | -1.450 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.165 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.490 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |