KANK2 KANK2
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 27
Residues 0–32 · 32 aa
(3.8% of protein) · Min inter-cluster distance: 6.474
P patches
Sequence
MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPY
Top exceptional features (|z-score| rank)
P Patch: +5.44Frac P: +3.27PPII: +2.97Frac F: +2.73Frac Aromatic: +2.37hyd-hyd: +2.21E/D Ratio: -2.03Frac Polar: -1.92
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.651 |
| pol-hyd | -1.182 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | -0.531 |
| pol-pro | -0.242 |
| pol-gly | +0.000 |
| hyd-hyd | +2.209 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.694 |
| hyd-pro | +1.510 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -0.918 |
| ala-pro | -0.833 |
| ala-gly | +0.000 |
| pro-pro | -0.139 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +1.447 |
| Frac C | -0.582 |
| Frac D | +0.270 |
| Frac E | -1.354 |
| Frac F | +2.728 |
| Frac G | -0.337 |
| Frac H | +0.294 |
| Frac I | -0.900 |
| Frac K | -0.528 |
| Frac L | -0.786 |
| Frac M | +0.776 |
| Frac N | -0.989 |
| Frac P | +3.271 |
| Frac Q | -0.515 |
| Frac R | -1.304 |
| Frac S | -1.405 |
| Frac T | -0.583 |
| Frac V | +0.973 |
| Frac W | -0.508 |
| Frac Y | +1.242 |
| Frac K+R | -1.263 |
| Frac D+E | -0.908 |
| Frac Polar | -1.920 |
| Frac Aliphatic | +1.228 |
| Frac Aromatic | +2.370 |
| R/K Ratio | -0.864 |
| E/D Ratio | -2.028 |
| Frac Chain Expanding | +0.569 |
| FCR | -1.510 |
| NCPR | -0.145 |
| Hydrophobicity | +1.695 |
| Disorder Promoting | -0.371 |
| Iso point | -0.675 |
| PPII | +2.966 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +5.436 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 27
Residues 154–186 · 32 aa
(3.8% of protein) · Min inter-cluster distance: 0.732
P patches
Sequence
STASLVGVGLPPPTPRSSGLSTPVPPSAGHLA
Top exceptional features (|z-score| rank)
Hydrophobicity: +2.78pro-gly: +2.23Frac V: +2.11FCR: -2.05Iso point: +1.98Frac L: +1.90Frac Aliphatic: +1.74hyd-pro: +1.64
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.549 |
| pol-hyd | +0.063 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.380 |
| pol-gly | -0.457 |
| hyd-hyd | -0.148 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.637 |
| hyd-gly | -1.279 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.389 |
| pro-gly | +2.233 |
| gly-gly | -0.330 |
| Frac A | +0.300 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -1.354 |
| Frac F | -0.807 |
| Frac G | +0.674 |
| Frac H | +0.294 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +1.900 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.499 |
| Frac Q | -1.207 |
| Frac R | -0.685 |
| Frac S | +0.936 |
| Frac T | +0.820 |
| Frac V | +2.114 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.263 |
| Frac D+E | -1.627 |
| Frac Polar | +0.539 |
| Frac Aliphatic | +1.738 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.598 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -1.327 |
| FCR | -2.052 |
| NCPR | +0.399 |
| Hydrophobicity | +2.783 |
| Disorder Promoting | -0.371 |
| Iso point | +1.982 |
| PPII | +0.515 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.283 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 24
Residues 407–586 · 179 aa
(21.0% of protein) · Min inter-cluster distance: 4.112
Weak negative charge
Sequence
TERSCDGAAGLPEVPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVRSIMKRKEEVADPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPSVAEAPQLRPAGTAAAKTSRQECQLSRESQHIPTAEGASGSNTEEEI
Top exceptional features (|z-score| rank)
pol-neg: -1.64E/D Ratio: +1.44R/K Ratio: +0.95Iso point: -0.94Frac L: -0.88Frac E: +0.83hyd-ala: +0.79Disorder Promoting: +0.75
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.501 |
| pol-hyd | +0.443 |
| pol-pos | +0.000 |
| pol-neg | -1.643 |
| pol-aro | +0.000 |
| pol-ala | +0.635 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.214 |
| hyd-pos | +0.000 |
| hyd-neg | +0.187 |
| hyd-aro | +0.000 |
| hyd-ala | +0.790 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.131 |
| neg-aro | +0.000 |
| neg-ala | -0.071 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.704 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.630 |
| Frac C | +0.180 |
| Frac D | -0.562 |
| Frac E | +0.829 |
| Frac F | -0.491 |
| Frac G | +0.008 |
| Frac H | -0.236 |
| Frac I | +0.226 |
| Frac K | -0.686 |
| Frac L | -0.881 |
| Frac M | -0.544 |
| Frac N | -0.093 |
| Frac P | -0.257 |
| Frac Q | -0.094 |
| Frac R | +0.136 |
| Frac S | +0.219 |
| Frac T | +0.471 |
| Frac V | +0.526 |
| Frac W | -0.508 |
| Frac Y | -0.278 |
| Frac K+R | -0.420 |
| Frac D+E | +0.366 |
| Frac Polar | +0.247 |
| Frac Aliphatic | +0.194 |
| Frac Aromatic | -0.706 |
| R/K Ratio | +0.952 |
| E/D Ratio | +1.438 |
| Frac Chain Expanding | -0.183 |
| FCR | +0.000 |
| NCPR | -0.554 |
| Hydrophobicity | +0.121 |
| Disorder Promoting | +0.748 |
| Iso point | -0.944 |
| PPII | -0.197 |
| A Patch | +0.406 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.379 |
| F Patch | -0.012 |
| G Patch | +0.050 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.213 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |