KANK4 KANK4
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 29
Residues 58–159 · 101 aa
(10.2% of protein) · Min inter-cluster distance: 0.733
High R fraction
Sequence
RRAKQAKFSTLPRNFSLPDSGARPPAAPPLQNWSPVVPREASLGTQEQNQSPPLGNAPQASTSRSEVSYHRKALLAEATRQLEAAEPEDAELTFGSGRPQL
Top exceptional features (|z-score| rank)
pol-ala: +1.78Frac L: +1.16Frac A: +1.12hyd-hyd: -1.11pol-pro: +1.07Frac Aliphatic: +1.00E Patch: +0.94pos-ala: -0.91
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.582 |
| pol-hyd | +0.638 |
| pol-pos | +0.444 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +1.782 |
| pol-pro | +1.074 |
| pol-gly | +0.000 |
| hyd-hyd | -1.107 |
| hyd-pos | -0.578 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | -0.298 |
| hyd-pro | -0.655 |
| hyd-gly | +0.000 |
| pos-pos | -0.015 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | -0.906 |
| pos-pro | +0.760 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.871 |
| ala-pro | -0.463 |
| ala-gly | +0.000 |
| pro-pro | +0.604 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +1.123 |
| Frac C | -0.582 |
| Frac D | -0.758 |
| Frac E | -0.163 |
| Frac F | +0.873 |
| Frac G | -0.547 |
| Frac H | -0.487 |
| Frac I | -0.900 |
| Frac K | -0.556 |
| Frac L | +1.155 |
| Frac M | -0.832 |
| Frac N | +0.281 |
| Frac P | +0.222 |
| Frac Q | +0.547 |
| Frac R | +0.463 |
| Frac S | -0.242 |
| Frac T | -0.173 |
| Frac V | -0.226 |
| Frac W | +0.393 |
| Frac Y | -0.022 |
| Frac K+R | -0.105 |
| Frac D+E | -0.487 |
| Frac Polar | -0.453 |
| Frac Aliphatic | +1.001 |
| Frac Aromatic | +0.722 |
| R/K Ratio | +0.833 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.351 |
| FCR | -0.436 |
| NCPR | +0.300 |
| Hydrophobicity | +0.531 |
| Disorder Promoting | -0.354 |
| Iso point | +0.805 |
| PPII | +0.282 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.940 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.211 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.414 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 27
Residues 162–235 · 73 aa
(7.3% of protein) · Min inter-cluster distance: 7.178
P patches
Sequence
SSMPATLLHSRASEEPGLSLGPPAPPALPPLQGEGSVCDGTFEPAEGLAGFHSSSPRASTRIPELVQEGAEPP
Top exceptional features (|z-score| rank)
ala-pro: -1.65Hydrophobicity: +1.64pol-pro: +1.64neg-gly: -1.50Frac L: +1.46E/D Ratio: +1.44ala-ala: -1.33R/K Ratio: +1.33
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.695 |
| pol-hyd | +0.116 |
| pol-pos | +0.000 |
| pol-neg | +0.704 |
| pol-aro | +0.000 |
| pol-ala | +0.138 |
| pol-pro | +1.636 |
| pol-gly | +0.244 |
| hyd-hyd | +0.172 |
| hyd-pos | +0.000 |
| hyd-neg | +0.167 |
| hyd-aro | +0.000 |
| hyd-ala | -0.137 |
| hyd-pro | -0.246 |
| hyd-gly | -0.504 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.633 |
| neg-aro | +0.000 |
| neg-ala | -0.478 |
| neg-pro | +0.895 |
| neg-gly | -1.503 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -1.328 |
| ala-pro | -1.647 |
| ala-gly | -0.270 |
| pro-pro | +0.705 |
| pro-gly | +0.688 |
| gly-gly | -0.318 |
| Frac A | +0.590 |
| Frac C | +0.352 |
| Frac D | -0.905 |
| Frac E | +0.293 |
| Frac F | +0.742 |
| Frac G | +0.425 |
| Frac H | +0.153 |
| Frac I | -0.210 |
| Frac K | -1.083 |
| Frac L | +1.458 |
| Frac M | -0.127 |
| Frac N | -0.989 |
| Frac P | +0.922 |
| Frac Q | -0.601 |
| Frac R | -0.489 |
| Frac S | +0.179 |
| Frac T | -0.362 |
| Frac V | -0.310 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.133 |
| Frac D+E | -0.208 |
| Frac Polar | -0.261 |
| Frac Aliphatic | +1.109 |
| Frac Aromatic | -0.102 |
| R/K Ratio | +1.328 |
| E/D Ratio | +1.438 |
| Frac Chain Expanding | -0.392 |
| FCR | -0.899 |
| NCPR | -0.588 |
| Hydrophobicity | +1.642 |
| Disorder Promoting | -0.133 |
| Iso point | -1.011 |
| PPII | +0.321 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.918 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 3
Residues 440–491 · 51 aa
(5.1% of protein) · Min inter-cluster distance: 0.065
Small negative blocks
Sequence
ESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSSV
Top exceptional features (|z-score| rank)
L Patch: +11.16Frac W: +3.06hyd-hyd: +2.55Frac L: +2.25hyd-gly: +1.92Disorder Promoting: -1.37hyd-neg: +1.24E/D Ratio: +1.10
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.467 |
| pol-hyd | +0.751 |
| pol-pos | +0.000 |
| pol-neg | +0.289 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -0.726 |
| hyd-hyd | +2.548 |
| hyd-pos | +0.000 |
| hyd-neg | +1.237 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +1.920 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.003 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | -1.098 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -0.364 |
| Frac A | -1.061 |
| Frac C | -0.582 |
| Frac D | -0.762 |
| Frac E | +0.414 |
| Frac F | -0.807 |
| Frac G | +0.872 |
| Frac H | +0.586 |
| Frac I | -0.900 |
| Frac K | -0.735 |
| Frac L | +2.251 |
| Frac M | -0.832 |
| Frac N | +0.269 |
| Frac P | -0.213 |
| Frac Q | +0.964 |
| Frac R | -0.527 |
| Frac S | -0.111 |
| Frac T | -0.844 |
| Frac V | +0.838 |
| Frac W | +3.060 |
| Frac Y | -0.609 |
| Frac K+R | -0.899 |
| Frac D+E | -0.047 |
| Frac Polar | +0.672 |
| Frac Aliphatic | +0.158 |
| Frac Aromatic | +0.338 |
| R/K Ratio | +0.294 |
| E/D Ratio | +1.104 |
| Frac Chain Expanding | -0.881 |
| FCR | -0.624 |
| NCPR | -0.556 |
| Hydrophobicity | +0.435 |
| Disorder Promoting | -1.373 |
| Iso point | -0.910 |
| PPII | -0.612 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | +11.160 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 24
Residues 494–562 · 68 aa
(6.8% of protein) · Min inter-cluster distance: 0.278
Weak negative charge
Sequence
LSTELRIEEAGTEQEGGPQGGTRGAGGFLWGSDRKTPPAGREETSSNLPGKEHPGRPPSSPTDATIGQ
Top exceptional features (|z-score| rank)
neg-pro: +1.93Frac G: +1.74G Patch: +1.70Frac V: -1.31Disorder Promoting: +1.18pro-pro: +1.17Frac T: +1.03Frac Aliphatic: -0.96
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.209 |
| pol-hyd | +0.000 |
| pol-pos | +0.138 |
| pol-neg | -0.678 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.391 |
| pol-gly | +0.756 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.596 |
| pos-neg | -0.780 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.664 |
| pos-gly | -0.042 |
| neg-neg | +0.459 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +1.925 |
| neg-gly | +0.690 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.169 |
| pro-gly | +0.443 |
| gly-gly | +0.132 |
| Frac A | -0.341 |
| Frac C | -0.582 |
| Frac D | -0.526 |
| Frac E | +0.414 |
| Frac F | +0.025 |
| Frac G | +1.744 |
| Frac H | -0.311 |
| Frac I | +0.583 |
| Frac K | -0.561 |
| Frac L | +0.004 |
| Frac M | -0.832 |
| Frac N | -0.517 |
| Frac P | +0.065 |
| Frac Q | -0.230 |
| Frac R | +0.154 |
| Frac S | -0.551 |
| Frac T | +1.026 |
| Frac V | -1.311 |
| Frac W | +0.830 |
| Frac Y | -0.609 |
| Frac K+R | -0.315 |
| Frac D+E | +0.066 |
| Frac Polar | +0.720 |
| Frac Aliphatic | -0.962 |
| Frac Aromatic | -0.027 |
| R/K Ratio | +0.598 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.137 |
| FCR | -0.157 |
| NCPR | -0.257 |
| Hydrophobicity | -0.092 |
| Disorder Promoting | +1.181 |
| Iso point | -0.876 |
| PPII | -0.443 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +1.695 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.856 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 6
Residues 609–644 · 35 aa
(3.5% of protein) · Min inter-cluster distance: 2.357
S patches
Sequence
LLSAYSAQAHPPKEPPASSSSPPVEISPSTSLKSI
Top exceptional features (|z-score| rank)
S Patch: +3.39Frac S: +2.41Frac I: +1.98hyd-hyd: +1.82Hydrophobicity: +1.70P Patch: +1.45Frac G: -1.35FCR: -1.33
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.598 |
| pol-hyd | +0.926 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.353 |
| pol-pro | +0.708 |
| pol-gly | +0.000 |
| hyd-hyd | +1.820 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.742 |
| hyd-pro | +0.811 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.971 |
| ala-pro | +1.161 |
| ala-gly | +0.000 |
| pro-pro | +0.535 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.677 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.495 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | +0.196 |
| Frac I | +1.981 |
| Frac K | -0.068 |
| Frac L | +0.774 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.233 |
| Frac Q | -0.575 |
| Frac R | -1.304 |
| Frac S | +2.408 |
| Frac T | -0.643 |
| Frac V | -0.267 |
| Frac W | -0.508 |
| Frac Y | +1.083 |
| Frac K+R | -0.921 |
| Frac D+E | -0.969 |
| Frac Polar | -0.111 |
| Frac Aliphatic | +1.301 |
| Frac Aromatic | -0.058 |
| R/K Ratio | -1.292 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.677 |
| FCR | -1.332 |
| NCPR | +0.127 |
| Hydrophobicity | +1.704 |
| Disorder Promoting | -0.034 |
| Iso point | +0.132 |
| PPII | +1.107 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.451 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +3.393 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 6
Cluster 4
Residues 662–706 · 44 aa
(4.4% of protein) · Min inter-cluster distance: 2.711
Weak negative charge, high N fraction
Sequence
LQFVGVNGGYETTSSEETSGEDSTPEDLSDSEAEKKCDGPDHKH
Top exceptional features (|z-score| rank)
NCPR: -1.65R/K Ratio: -1.59pol-neg: -1.54Frac D+E: +1.51Frac Aliphatic: -1.51Frac D: +1.50PPII: -1.32Frac R: -1.30
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.107 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | -1.537 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -0.032 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.460 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.571 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.426 |
| Frac A | -1.003 |
| Frac C | +0.968 |
| Frac D | +1.501 |
| Frac E | +1.037 |
| Frac F | +0.478 |
| Frac G | +0.490 |
| Frac H | +0.814 |
| Frac I | -0.900 |
| Frac K | +0.128 |
| Frac L | -0.379 |
| Frac M | -0.832 |
| Frac N | -0.260 |
| Frac P | -0.959 |
| Frac Q | -0.704 |
| Frac R | -1.304 |
| Frac S | +0.170 |
| Frac T | +0.756 |
| Frac V | +0.350 |
| Frac W | -0.508 |
| Frac Y | +0.737 |
| Frac K+R | -0.775 |
| Frac D+E | +1.512 |
| Frac Polar | +0.707 |
| Frac Aliphatic | -1.507 |
| Frac Aromatic | +0.571 |
| R/K Ratio | -1.595 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | +0.052 |
| FCR | +0.630 |
| NCPR | -1.653 |
| Hydrophobicity | -0.507 |
| Disorder Promoting | +0.292 |
| Iso point | -1.112 |
| PPII | -1.320 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |