LMX1B LMX1B
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 12
Residues 172–242 · 70 aa
(17.4% of protein) · Min inter-cluster distance: 2.563
Blocks of positive, negative & polar residues
Sequence
KDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSS
Top exceptional features (|z-score| rank)
pos-neg: +2.96pol-neg: +2.64neg-neg: +2.11R Patch: +2.09hyd-neg: +2.06pol-pos: +2.06Frac D: +1.86hyd-pos: +1.84
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.795 |
| pol-hyd | -0.335 |
| pol-pos | +2.058 |
| pol-neg | +2.636 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.944 |
| hyd-pos | +1.840 |
| hyd-neg | +2.060 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.609 |
| pos-neg | +2.959 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.114 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.634 |
| Frac C | -0.582 |
| Frac D | +1.861 |
| Frac E | -0.495 |
| Frac F | +0.809 |
| Frac G | +0.039 |
| Frac H | -0.849 |
| Frac I | -0.180 |
| Frac K | +0.947 |
| Frac L | -0.453 |
| Frac M | -0.097 |
| Frac N | -0.989 |
| Frac P | -0.591 |
| Frac Q | +0.058 |
| Frac R | +0.395 |
| Frac S | +0.695 |
| Frac T | -0.322 |
| Frac V | +0.255 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.969 |
| Frac D+E | +0.510 |
| Frac Polar | -0.251 |
| Frac Aliphatic | -0.797 |
| Frac Aromatic | -0.058 |
| R/K Ratio | -0.398 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | +0.768 |
| FCR | +1.018 |
| NCPR | +0.252 |
| Hydrophobicity | -0.694 |
| Disorder Promoting | +0.992 |
| Iso point | +0.536 |
| PPII | -0.397 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +2.093 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 10
Residues 304–355 · 51 aa
(12.7% of protein) · Min inter-cluster distance: 10.05
Well-mixed hydrophobics, enriched in M
Sequence
MMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGDHMNPYGNDSI
Top exceptional features (|z-score| rank)
Frac M: +4.21Frac Y: +2.88Disorder Promoting: -2.08Frac Q: +1.83Frac Aromatic: +1.80Frac K+R: -1.68FCR: -1.64E/D Ratio: -1.49
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.364 |
| pol-hyd | -0.666 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.135 |
| pol-gly | +0.000 |
| hyd-hyd | -0.136 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.267 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.707 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.341 |
| Frac C | -0.582 |
| Frac D | +0.182 |
| Frac E | -1.059 |
| Frac F | +0.302 |
| Frac G | -0.079 |
| Frac H | -0.132 |
| Frac I | +1.077 |
| Frac K | -1.083 |
| Frac L | -0.558 |
| Frac M | +4.212 |
| Frac N | +0.269 |
| Frac P | +0.899 |
| Frac Q | +1.833 |
| Frac R | -1.304 |
| Frac S | -0.404 |
| Frac T | -0.404 |
| Frac V | -0.595 |
| Frac W | -0.508 |
| Frac Y | +2.875 |
| Frac K+R | -1.677 |
| Frac D+E | -0.724 |
| Frac Polar | +0.286 |
| Frac Aliphatic | +0.798 |
| Frac Aromatic | +1.800 |
| R/K Ratio | -0.133 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | -1.277 |
| FCR | -1.643 |
| NCPR | -0.556 |
| Hydrophobicity | +0.861 |
| Disorder Promoting | -2.077 |
| Iso point | -1.213 |
| PPII | +0.804 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |