LRIG2 LRIG2
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 28
Residues 856–891 · 35 aa
(3.3% of protein) · Min inter-cluster distance: 1.22
High aromatic fraction, specifically Ys
Sequence
SSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKG
Top exceptional features (|z-score| rank)
Frac Y: +2.77Frac Polar: +1.86Frac Chain Expanding: -1.83gly-gly: -1.62FCR: -1.33Frac Q: +1.32Frac V: -1.31Frac R: -1.30
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.244 |
| pol-hyd | -0.461 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -1.007 |
| hyd-hyd | +0.436 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | -0.023 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -1.616 |
| Frac A | -0.372 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.066 |
| Frac F | -0.807 |
| Frac G | +0.963 |
| Frac H | +1.241 |
| Frac I | +0.540 |
| Frac K | -0.576 |
| Frac L | -0.044 |
| Frac M | +0.638 |
| Frac N | +0.844 |
| Frac P | -0.388 |
| Frac Q | +1.324 |
| Frac R | -1.304 |
| Frac S | +0.695 |
| Frac T | -0.643 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | +2.775 |
| Frac K+R | -1.299 |
| Frac D+E | -0.641 |
| Frac Polar | +1.857 |
| Frac Aliphatic | -0.564 |
| Frac Aromatic | +1.006 |
| R/K Ratio | -0.864 |
| E/D Ratio | +1.282 |
| Frac Chain Expanding | -1.833 |
| FCR | -1.332 |
| NCPR | -0.370 |
| Hydrophobicity | -0.062 |
| Disorder Promoting | -0.548 |
| Iso point | -0.675 |
| PPII | -0.826 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 17
Residues 953–996 · 43 aa
(4.0% of protein) · Min inter-cluster distance: 0.214
Weak positive charge
Sequence
TTALESLIPSANREPSAFPTNHERISEKKLPSTQMSGETLQRP
Top exceptional features (|z-score| rank)
E/D Ratio: +1.82neg-neg: -1.67Frac I: +1.45pos-neg: -1.35Frac T: +1.32pol-hyd: -1.31Frac V: -1.31hyd-neg: -1.25
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.955 |
| pol-hyd | -1.315 |
| pol-pos | -0.411 |
| pol-neg | -0.857 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.167 |
| pol-gly | +0.000 |
| hyd-hyd | -1.104 |
| hyd-pos | -0.247 |
| hyd-neg | -1.246 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.331 |
| hyd-gly | +0.000 |
| pos-pos | +0.666 |
| pos-neg | -1.354 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.370 |
| pos-gly | +0.000 |
| neg-neg | -1.670 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.178 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.072 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.140 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | +0.394 |
| Frac F | +0.508 |
| Frac G | -0.971 |
| Frac H | +0.002 |
| Frac I | +1.445 |
| Frac K | -0.257 |
| Frac L | +0.984 |
| Frac M | +0.365 |
| Frac N | +0.503 |
| Frac P | +0.045 |
| Frac Q | -0.177 |
| Frac R | +0.079 |
| Frac S | +0.217 |
| Frac T | +1.325 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.139 |
| Frac D+E | -0.289 |
| Frac Polar | +0.125 |
| Frac Aliphatic | +0.433 |
| Frac Aromatic | -0.256 |
| R/K Ratio | +0.170 |
| E/D Ratio | +1.822 |
| Frac Chain Expanding | -0.327 |
| FCR | -0.308 |
| NCPR | +0.127 |
| Hydrophobicity | +0.429 |
| Disorder Promoting | -0.619 |
| Iso point | +0.401 |
| PPII | +0.153 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 6
Residues 998–1044 · 46 aa
(4.3% of protein) · Min inter-cluster distance: 1.624
S patches
Sequence
NINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHR
Top exceptional features (|z-score| rank)
Frac C: +2.38Frac H: +2.33pol-pol: +1.62Disorder Promoting: -1.52R/K Ratio: +1.33Frac T: -1.28hyd-hyd: -1.28Frac N: +1.10
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.624 |
| pol-hyd | -0.937 |
| pol-pos | +0.000 |
| pol-neg | +0.365 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.060 |
| pol-gly | +0.000 |
| hyd-hyd | -1.281 |
| hyd-pos | +0.000 |
| hyd-neg | -0.779 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.090 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.529 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.310 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.220 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.623 |
| Frac C | +2.383 |
| Frac D | -0.711 |
| Frac E | -0.047 |
| Frac F | +0.422 |
| Frac G | -0.293 |
| Frac H | +2.332 |
| Frac I | +0.196 |
| Frac K | -1.083 |
| Frac L | +0.810 |
| Frac M | +0.287 |
| Frac N | +1.103 |
| Frac P | +0.246 |
| Frac Q | +0.719 |
| Frac R | -0.011 |
| Frac S | +0.081 |
| Frac T | -1.284 |
| Frac V | -0.517 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.814 |
| Frac D+E | -0.376 |
| Frac Polar | +0.940 |
| Frac Aliphatic | -0.169 |
| Frac Aromatic | -0.313 |
| R/K Ratio | +1.328 |
| E/D Ratio | +0.656 |
| Frac Chain Expanding | -0.777 |
| FCR | -0.816 |
| NCPR | -0.251 |
| Hydrophobicity | +0.162 |
| Disorder Promoting | -1.518 |
| Iso point | -0.271 |
| PPII | -0.187 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.993 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |