MYH9 MYH9
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 19
Residues 1113–1167 · 54 aa
(2.8% of protein) · Min inter-cluster distance: 12.793
High negative fraction, specifically Es
Sequence
SELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQ
Top exceptional features (|z-score| rank)
Frac L: +2.56hyd-neg: -2.32E Patch: +2.06Frac E: +1.99FCR: +1.85pos-pos: +1.84Frac D+E: +1.78Frac P: -1.60
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.730 |
| pol-hyd | -0.612 |
| pol-pos | -0.562 |
| pol-neg | -0.375 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.017 |
| hyd-pos | +1.102 |
| hyd-neg | -2.322 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.840 |
| pos-neg | +1.184 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.579 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.279 |
| Frac C | -0.582 |
| Frac D | +0.549 |
| Frac E | +1.986 |
| Frac F | -0.807 |
| Frac G | -1.048 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +0.561 |
| Frac L | +2.563 |
| Frac M | -0.832 |
| Frac N | -0.395 |
| Frac P | -1.604 |
| Frac Q | +0.843 |
| Frac R | +0.532 |
| Frac S | -0.486 |
| Frac T | -0.037 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.773 |
| Frac D+E | +1.783 |
| Frac Polar | -1.032 |
| Frac Aliphatic | +0.567 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +0.708 |
| Frac Chain Expanding | +1.014 |
| FCR | +1.848 |
| NCPR | -0.840 |
| Hydrophobicity | -1.108 |
| Disorder Promoting | +0.564 |
| Iso point | -0.977 |
| PPII | -0.736 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +2.062 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 9
Residues 1850–1960 · 110 aa
(5.6% of protein) · Min inter-cluster distance: 5.819
Blocks of positive & negative residues
Sequence
VDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Top exceptional features (|z-score| rank)
pos-neg: +2.80hyd-pos: -1.66hyd-ala: +1.66neg-neg: +1.66Frac Polar: -1.62FCR: +1.61A Patch: +1.37pol-pos: -1.25
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.106 |
| pol-hyd | -0.591 |
| pol-pos | -1.253 |
| pol-neg | +0.694 |
| pol-aro | +0.000 |
| pol-ala | -0.694 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.072 |
| hyd-pos | -1.662 |
| hyd-neg | +0.907 |
| hyd-aro | +0.000 |
| hyd-ala | +1.662 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.238 |
| pos-neg | +2.796 |
| pos-aro | +0.000 |
| pos-ala | +0.335 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.661 |
| neg-aro | +0.000 |
| neg-ala | -0.613 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.671 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +1.248 |
| Frac C | -0.582 |
| Frac D | +1.173 |
| Frac E | +0.695 |
| Frac F | -0.293 |
| Frac G | -0.465 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +0.532 |
| Frac L | +0.402 |
| Frac M | +0.104 |
| Frac N | +0.177 |
| Frac P | -1.217 |
| Frac Q | +0.001 |
| Frac R | +1.220 |
| Frac S | -1.192 |
| Frac T | -0.672 |
| Frac V | +0.350 |
| Frac W | -0.508 |
| Frac Y | -0.070 |
| Frac K+R | +1.209 |
| Frac D+E | +1.093 |
| Frac Polar | -1.618 |
| Frac Aliphatic | +1.237 |
| Frac Aromatic | -0.445 |
| R/K Ratio | +0.194 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | +1.018 |
| FCR | +1.615 |
| NCPR | -0.031 |
| Hydrophobicity | -0.718 |
| Disorder Promoting | +0.129 |
| Iso point | -0.675 |
| PPII | -0.535 |
| A Patch | +1.372 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.440 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |