IDR 1
Cluster 1
Residues 917–1057 · 140 aa
(12.6% of protein) · Min inter-cluster distance: 1.696
Blocks of P & polar residues
Sequence
VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCK
Top exceptional features (|z-score| rank)
pol-pro: +4.73pol-pol: +3.86pol-hyd: +3.11Frac Y: +1.93pro-pro: +1.64E/D Ratio: -1.49Iso point: +1.34Frac D+E: -1.30
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +3.862 |
| pol-hyd | +3.112 |
| pol-pos | +0.932 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +4.726 |
| pol-gly | +0.000 |
| hyd-hyd | -0.240 |
| hyd-pos | -0.922 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.014 |
| hyd-gly | +0.000 |
| pos-pos | -0.379 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.460 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.635 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.372 |
| Frac C | -0.095 |
| Frac D | -0.719 |
| Frac E | -1.246 |
| Frac F | -0.403 |
| Frac G | -0.077 |
| Frac H | -0.327 |
| Frac I | -0.180 |
| Frac K | -0.195 |
| Frac L | -0.658 |
| Frac M | -0.464 |
| Frac N | +0.844 |
| Frac P | +0.929 |
| Frac Q | +1.007 |
| Frac R | +0.537 |
| Frac S | -0.375 |
| Frac T | +0.319 |
| Frac V | +0.777 |
| Frac W | -0.508 |
| Frac Y | +1.929 |
| Frac K+R | +0.213 |
| Frac D+E | -1.298 |
| Frac Polar | +0.451 |
| Frac Aliphatic | -0.564 |
| Frac Aromatic | +0.740 |
| R/K Ratio | +0.457 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | -0.316 |
| FCR | -0.837 |
| NCPR | +1.122 |
| Hydrophobicity | -0.281 |
| Disorder Promoting | -0.548 |
| Iso point | +1.343 |
| PPII | +1.014 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.819 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |