NPHP1 NPHP1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 7
Residues 102–156 · 54 aa
(7.4% of protein) · Min inter-cluster distance: 23.668
D/E-tracts
Sequence
ISRENITEVGAPTEEEEESESEDSEDSGGEEEDAEEEEEEKEENESHKWSTGEE
Top exceptional features (|z-score| rank)
E Patch: +7.15Frac E: +5.33Frac D+E: +4.13NCPR: -3.74FCR: +2.49neg-neg: +2.17Hydrophobicity: -2.16Frac Chain Expanding: +1.95
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.689 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +1.843 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +2.174 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.741 |
| Frac C | -0.582 |
| Frac D | +0.103 |
| Frac E | +5.325 |
| Frac F | -0.807 |
| Frac G | -0.150 |
| Frac H | -0.172 |
| Frac I | +0.967 |
| Frac K | -0.425 |
| Frac L | -1.681 |
| Frac M | -0.832 |
| Frac N | +0.199 |
| Frac P | -1.341 |
| Frac Q | -1.207 |
| Frac R | -0.937 |
| Frac S | +0.069 |
| Frac T | -0.037 |
| Frac V | -0.634 |
| Frac W | +1.177 |
| Frac Y | -0.609 |
| Frac K+R | -0.942 |
| Frac D+E | +4.128 |
| Frac Polar | -0.668 |
| Frac Aliphatic | -1.850 |
| Frac Aromatic | -0.433 |
| R/K Ratio | -0.561 |
| E/D Ratio | +1.876 |
| Frac Chain Expanding | +1.951 |
| FCR | +2.490 |
| NCPR | -3.742 |
| Hydrophobicity | -2.159 |
| Disorder Promoting | +1.563 |
| Iso point | -1.280 |
| PPII | -0.882 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +7.151 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.402 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 19
Residues 197–244 · 47 aa
(6.4% of protein) · Min inter-cluster distance: 3.325
High negative fraction, specifically Es
Sequence
NEGLVPRTYLEPYSEEEEGQESSEEGSEEDVEAVDETADGAEVKQRT
Top exceptional features (|z-score| rank)
E Patch: +5.19Frac E: +3.12Frac D+E: +2.54NCPR: -2.47Frac Y: +1.91Frac V: +1.80FCR: +1.36Iso point: -1.25
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.328 |
| pol-hyd | +0.097 |
| pol-pos | +0.000 |
| pol-neg | -0.330 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.086 |
| hyd-pos | +0.000 |
| hyd-neg | +0.817 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.278 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.249 |
| Frac C | -0.582 |
| Frac D | +0.302 |
| Frac E | +3.122 |
| Frac F | -0.807 |
| Frac G | +0.029 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.705 |
| Frac L | -0.462 |
| Frac M | -0.832 |
| Frac N | -0.307 |
| Frac P | -1.000 |
| Frac Q | -0.265 |
| Frac R | -0.461 |
| Frac S | -0.598 |
| Frac T | +0.148 |
| Frac V | +1.799 |
| Frac W | -0.508 |
| Frac Y | +1.911 |
| Frac K+R | -0.832 |
| Frac D+E | +2.536 |
| Frac Polar | -0.834 |
| Frac Aliphatic | -0.237 |
| Frac Aromatic | +0.463 |
| R/K Ratio | +0.294 |
| E/D Ratio | +1.196 |
| Frac Chain Expanding | +0.879 |
| FCR | +1.363 |
| NCPR | -2.466 |
| Hydrophobicity | -0.682 |
| Disorder Promoting | +0.119 |
| Iso point | -1.246 |
| PPII | -0.656 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +5.190 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |