NPHP4 NPHP4
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 27
Residues 446–547 · 101 aa
(7.1% of protein) · Min inter-cluster distance: 10.331
P patches
Sequence
FSLGSEEHLDAPTEPVSGPKVERRPSRKPPTSPSSPPAPVPRVLAAPQNSPVGPGLSISQLAASPRSPTQHCLARPTSQLPHGSQASPAQAQEFPLEAGIS
Top exceptional features (|z-score| rank)
pro-pro: -1.48Frac P: +1.21ala-ala: +1.17Hydrophobicity: +1.11E/D Ratio: +1.10PPII: +1.06FCR: -1.04Frac D: -1.00
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.880 |
| pol-hyd | +0.605 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.381 |
| pol-pro | -0.798 |
| pol-gly | +0.000 |
| hyd-hyd | -0.769 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | -0.470 |
| hyd-pro | -0.381 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +1.172 |
| ala-pro | -0.447 |
| ala-gly | +0.000 |
| pro-pro | -1.484 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.578 |
| Frac C | +0.093 |
| Frac D | -0.996 |
| Frac E | -0.461 |
| Frac F | +0.313 |
| Frac G | -0.387 |
| Frac H | +0.237 |
| Frac I | +0.098 |
| Frac K | -0.731 |
| Frac L | +0.588 |
| Frac M | -0.832 |
| Frac N | -0.672 |
| Frac P | +1.205 |
| Frac Q | +0.328 |
| Frac R | -0.126 |
| Frac S | +0.500 |
| Frac T | -0.395 |
| Frac V | +0.498 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.629 |
| Frac D+E | -0.829 |
| Frac Polar | -0.063 |
| Frac Aliphatic | +0.839 |
| Frac Aromatic | -0.385 |
| R/K Ratio | +0.760 |
| E/D Ratio | +1.104 |
| Frac Chain Expanding | -0.351 |
| FCR | -1.036 |
| NCPR | +0.213 |
| Hydrophobicity | +1.115 |
| Disorder Promoting | +0.179 |
| Iso point | +0.401 |
| PPII | +1.057 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.978 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 6
Residues 834–871 · 37 aa
(2.6% of protein) · Min inter-cluster distance: 2.161
S patches
Sequence
KVRGCSTLPPSRSRVISNDGASRFSGGSLLTTGSSRR
Top exceptional features (|z-score| rank)
Frac R: +1.91Frac S: +1.77PPII: -1.74Iso point: +1.65NCPR: +1.54E/D Ratio: -1.49Frac E: -1.35pol-pol: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.352 |
| pol-hyd | -0.584 |
| pol-pos | +0.279 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -1.203 |
| hyd-hyd | +0.654 |
| hyd-pos | -0.107 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.119 |
| pos-pos | +1.339 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | -0.384 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -0.541 |
| Frac A | -0.924 |
| Frac C | +1.261 |
| Frac D | -0.584 |
| Frac E | -1.354 |
| Frac F | +0.721 |
| Frac G | +0.838 |
| Frac H | -0.849 |
| Frac I | +0.462 |
| Frac K | -0.603 |
| Frac L | +0.642 |
| Frac M | -0.832 |
| Frac N | -0.122 |
| Frac P | -0.837 |
| Frac Q | -1.207 |
| Frac R | +1.911 |
| Frac S | +1.772 |
| Frac T | +0.535 |
| Frac V | +0.664 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.826 |
| Frac D+E | -1.316 |
| Frac Polar | +1.287 |
| Frac Aliphatic | -0.274 |
| Frac Aromatic | -0.116 |
| R/K Ratio | +1.188 |
| E/D Ratio | -1.488 |
| Frac Chain Expanding | -1.122 |
| FCR | -0.450 |
| NCPR | +1.539 |
| Hydrophobicity | +1.142 |
| Disorder Promoting | -0.811 |
| Iso point | +1.646 |
| PPII | -1.737 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 29
Residues 893–940 · 47 aa
(3.3% of protein) · Min inter-cluster distance: 3.629
High R fraction
Sequence
HARQGKGPQDVSRESDATRRRKLERMRSVRLQEAGGDLGRRGTSVLA
Top exceptional features (|z-score| rank)
Frac R: +2.92gly-gly: +1.80Frac K+R: +1.70G Patch: +1.62pos-gly: +1.58Iso point: +1.51Frac P: -1.30NCPR: +1.24
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.349 |
| pol-hyd | -0.692 |
| pol-pos | +0.020 |
| pol-neg | -0.824 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.164 |
| hyd-hyd | +0.294 |
| hyd-pos | -0.167 |
| hyd-neg | -0.349 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.756 |
| pos-pos | +0.269 |
| pos-neg | +0.604 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +1.585 |
| neg-neg | -0.521 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.433 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +1.801 |
| Frac A | +0.141 |
| Frac C | -0.582 |
| Frac D | +0.302 |
| Frac E | -0.395 |
| Frac F | -0.807 |
| Frac G | +0.717 |
| Frac H | -0.071 |
| Frac I | -0.900 |
| Frac K | -0.327 |
| Frac L | +0.757 |
| Frac M | +0.263 |
| Frac N | -0.989 |
| Frac P | -1.302 |
| Frac Q | +0.206 |
| Frac R | +2.915 |
| Frac S | -0.598 |
| Frac T | -0.329 |
| Frac V | +1.021 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +1.701 |
| Frac D+E | -0.158 |
| Frac Polar | -0.416 |
| Frac Aliphatic | +0.805 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +1.237 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.233 |
| FCR | +0.995 |
| NCPR | +1.238 |
| Hydrophobicity | -0.374 |
| Disorder Promoting | +0.501 |
| Iso point | +1.511 |
| PPII | -1.229 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +1.625 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |