NPHS1 NPHN
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 27
Residues 1021–1057 · 36 aa
(2.9% of protein) · Min inter-cluster distance: 6.286
P patches
Sequence
SGLADKGTQLPITTPGLHQPSGEPEDQLPTEPPSGP
Top exceptional features (|z-score| rank)
P Patch: +2.01Frac P: +1.55Frac L: +1.50pol-pro: -1.46pol-hyd: -1.44gly-gly: -1.33Frac V: -1.31Frac K+R: -1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.643 |
| pol-hyd | -1.438 |
| pol-pos | +0.000 |
| pol-neg | +0.169 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.460 |
| pol-gly | -0.926 |
| hyd-hyd | -0.856 |
| hyd-pos | +0.000 |
| hyd-neg | +0.878 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.435 |
| hyd-gly | -0.516 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.088 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.819 |
| neg-gly | -0.257 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.913 |
| pro-gly | -0.582 |
| gly-gly | -1.333 |
| Frac A | -0.911 |
| Frac C | -0.582 |
| Frac D | +0.103 |
| Frac E | -0.101 |
| Frac F | -0.807 |
| Frac G | +0.898 |
| Frac H | +0.167 |
| Frac I | +0.500 |
| Frac K | -0.590 |
| Frac L | +1.502 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.548 |
| Frac Q | +0.638 |
| Frac R | -1.304 |
| Frac S | -0.625 |
| Frac T | +1.209 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.309 |
| Frac D+E | -0.028 |
| Frac Polar | +0.608 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | +0.078 |
| FCR | -0.879 |
| NCPR | -0.840 |
| Hydrophobicity | +0.341 |
| Disorder Promoting | +1.064 |
| Iso point | -1.112 |
| PPII | +1.160 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +2.014 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 28
Residues 1094–1165 · 71 aa
(5.7% of protein) · Min inter-cluster distance: 3.199
High aromatic fraction, specifically Ys
Sequence
EGISEKTEAGSEEDRVRNEYEESQWTGERDTQSSTVSTTEAEPYYRSLRDFSPQLPPTQEEVSYSRGFTGE
Top exceptional features (|z-score| rank)
Frac Y: +2.73Frac Aromatic: +2.55Frac E: +1.61Frac Aliphatic: -1.52Frac T: +1.24E/D Ratio: +1.20R/K Ratio: +1.19Frac D+E: +1.13
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.672 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.454 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.684 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.904 |
| Frac C | -0.582 |
| Frac D | -0.217 |
| Frac E | +1.609 |
| Frac F | +0.786 |
| Frac G | -0.209 |
| Frac H | -0.849 |
| Frac I | -0.190 |
| Frac K | -0.833 |
| Frac L | -0.874 |
| Frac M | -0.832 |
| Frac N | -0.537 |
| Frac P | -0.805 |
| Frac Q | +0.040 |
| Frac R | +0.371 |
| Frac S | +0.237 |
| Frac T | +1.244 |
| Frac V | +0.233 |
| Frac W | +0.774 |
| Frac Y | +2.728 |
| Frac K+R | -0.373 |
| Frac D+E | +1.129 |
| Frac Polar | +0.115 |
| Frac Aliphatic | -1.523 |
| Frac Aromatic | +2.551 |
| R/K Ratio | +1.188 |
| E/D Ratio | +1.196 |
| Frac Chain Expanding | +0.133 |
| FCR | +0.605 |
| NCPR | -1.099 |
| Hydrophobicity | -0.765 |
| Disorder Promoting | +0.016 |
| Iso point | -1.078 |
| PPII | -0.795 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |