NPHS2 PODO
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 29
Residues 0–95 · 95 aa
(24.8% of protein) · Min inter-cluster distance: 2.936
High R fraction
Sequence
MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAPAATVVDVDEVRGSGEEGTEVVALLESERPEEGTKS
Top exceptional features (|z-score| rank)
V Patch: +10.71R Patch: +1.97Frac R: +1.83Disorder Promoting: +1.67E/D Ratio: +1.67gly-gly: +1.51pol-pos: -1.39Frac G: +1.38
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -1.306 |
| pol-hyd | +0.000 |
| pol-pos | -1.390 |
| pol-neg | -0.587 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -0.216 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.407 |
| pos-neg | +0.288 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | -0.050 |
| neg-neg | -0.240 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +1.264 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +1.509 |
| Frac A | +0.318 |
| Frac C | -0.582 |
| Frac D | -0.728 |
| Frac E | +1.019 |
| Frac F | -0.807 |
| Frac G | +1.376 |
| Frac H | -0.464 |
| Frac I | -0.900 |
| Frac K | -0.335 |
| Frac L | -1.078 |
| Frac M | -0.290 |
| Frac N | -0.652 |
| Frac P | -0.559 |
| Frac Q | -0.974 |
| Frac R | +1.827 |
| Frac S | -0.296 |
| Frac T | -0.103 |
| Frac V | +0.997 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.969 |
| Frac D+E | +0.433 |
| Frac Polar | -0.244 |
| Frac Aliphatic | -0.270 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +1.093 |
| E/D Ratio | +1.665 |
| Frac Chain Expanding | +0.723 |
| FCR | +0.960 |
| NCPR | +0.310 |
| Hydrophobicity | -0.636 |
| Disorder Promoting | +1.668 |
| Iso point | +0.805 |
| PPII | -0.652 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.717 |
| F Patch | -0.012 |
| G Patch | +1.373 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +1.969 |
| S Patch | +0.232 |
| T Patch | -0.147 |
| V Patch | +10.706 |
| Y Patch | -0.022 |
| RG Frac | +1.297 |
IDR 2
Cluster 27
Residues 353–383 · 30 aa
(7.8% of protein) · Min inter-cluster distance: 2.142
P patches
Sequence
SNRTQGSLPFPSPSKPVEPLNPKKKDSPML
Top exceptional features (|z-score| rank)
P Patch: +4.72PPII: +1.77Frac P: +1.71Frac A: -1.42Frac K: +1.28hyd-pos: +1.26Disorder Promoting: -1.23Frac L: +1.18
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.230 |
| pol-hyd | +0.247 |
| pol-pos | -0.442 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.301 |
| pol-gly | +0.000 |
| hyd-hyd | +0.123 |
| hyd-pos | +1.258 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.692 |
| hyd-gly | +0.000 |
| pos-pos | +0.449 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.364 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.331 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | -0.432 |
| Frac E | -0.853 |
| Frac F | +1.078 |
| Frac G | -0.808 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +1.285 |
| Frac L | +1.184 |
| Frac M | +0.883 |
| Frac N | +1.149 |
| Frac P | +1.706 |
| Frac Q | -0.469 |
| Frac R | -0.643 |
| Frac S | +0.624 |
| Frac T | -0.536 |
| Frac V | -0.093 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.528 |
| Frac D+E | -0.860 |
| Frac Polar | -0.485 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | +0.119 |
| R/K Ratio | -1.100 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.865 |
| FCR | -0.301 |
| NCPR | +0.998 |
| Hydrophobicity | -0.068 |
| Disorder Promoting | -1.232 |
| Iso point | +0.939 |
| PPII | +1.770 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +4.721 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |