IDR 1
Cluster 16
Residues 160–215 · 55 aa
(6.1% of protein) · Min inter-cluster distance: 0.221
Blocks of polar residues
Sequence
DKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQ
Top exceptional features (|z-score| rank)
Frac N: +2.51pol-pro: +2.32hyd-pro: +2.23pol-pol: +2.07Disorder Promoting: -1.99pos-pro: +1.87PPII: +1.40hyd-pos: -1.33
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +2.066 |
| pol-hyd | +0.226 |
| pol-pos | +0.969 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.316 |
| pol-gly | +0.000 |
| hyd-hyd | -0.030 |
| hyd-pos | -1.333 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +2.229 |
| hyd-gly | +0.000 |
| pos-pos | -0.227 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +1.870 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.213 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.087 |
| Frac C | -0.582 |
| Frac D | -0.797 |
| Frac E | -0.261 |
| Frac F | +1.250 |
| Frac G | -1.053 |
| Frac H | -0.184 |
| Frac I | +0.933 |
| Frac K | +1.177 |
| Frac L | -0.639 |
| Frac M | +1.039 |
| Frac N | +2.510 |
| Frac P | +0.717 |
| Frac Q | +0.403 |
| Frac R | -0.223 |
| Frac S | -1.056 |
| Frac T | +0.348 |
| Frac V | +0.682 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.728 |
| Frac D+E | -0.581 |
| Frac Polar | -0.366 |
| Frac Aliphatic | -0.394 |
| Frac Aromatic | +0.232 |
| R/K Ratio | -0.864 |
| E/D Ratio | +0.656 |
| Frac Chain Expanding | +0.558 |
| FCR | +0.040 |
| NCPR | +0.919 |
| Hydrophobicity | -0.646 |
| Disorder Promoting | -1.994 |
| Iso point | +0.906 |
| PPII | +1.401 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.560 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |