PAX2 PAX2
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 15
Residues 142–181 · 39 aa
(9.4% of protein) · Min inter-cluster distance: 5.139
T patches
Sequence
VQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDP
Top exceptional features (|z-score| rank)
Frac V: +2.44E/D Ratio: -2.03FCR: -1.88Frac L: -1.68Frac K+R: -1.68pol-ala: -1.63Frac T: +1.59Hydrophobicity: +1.57
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.884 |
| pol-hyd | -0.550 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | -1.634 |
| pol-pro | -0.919 |
| pol-gly | -0.109 |
| hyd-hyd | +0.216 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | -0.118 |
| hyd-pro | -0.504 |
| hyd-gly | +0.409 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -1.473 |
| ala-pro | -0.545 |
| ala-gly | -1.019 |
| pro-pro | -0.430 |
| pro-gly | +0.694 |
| gly-gly | +1.130 |
| Frac A | +0.461 |
| Frac C | -0.582 |
| Frac D | +0.000 |
| Frac E | -1.354 |
| Frac F | +0.643 |
| Frac G | +0.311 |
| Frac H | +1.027 |
| Frac I | +0.392 |
| Frac K | -1.083 |
| Frac L | -1.681 |
| Frac M | -0.832 |
| Frac N | -0.167 |
| Frac P | +1.306 |
| Frac Q | -0.072 |
| Frac R | -1.304 |
| Frac S | +0.048 |
| Frac T | +1.593 |
| Frac V | +2.436 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | -1.037 |
| Frac Polar | +1.028 |
| Frac Aliphatic | +0.404 |
| Frac Aromatic | -0.167 |
| R/K Ratio | -0.133 |
| E/D Ratio | -2.028 |
| Frac Chain Expanding | -1.262 |
| FCR | -1.878 |
| NCPR | -0.319 |
| Hydrophobicity | +1.572 |
| Disorder Promoting | +0.334 |
| Iso point | -0.675 |
| PPII | +0.783 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 10
Residues 302–368 · 66 aa
(15.8% of protein) · Min inter-cluster distance: 2.111
Well-mixed hydrophobics, enriched in M
Sequence
VKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFS
Top exceptional features (|z-score| rank)
Frac Y: +2.08Frac V: +2.01Frac T: +1.78Hydrophobicity: +1.71Frac Chain Expanding: -1.71FCR: -1.67gly-gly: -1.39Disorder Promoting: -1.34
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.132 |
| pol-hyd | -0.367 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.293 |
| pol-gly | -0.284 |
| hyd-hyd | -1.070 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.511 |
| hyd-gly | -1.289 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.131 |
| pro-gly | -0.334 |
| gly-gly | -1.393 |
| Frac A | -0.586 |
| Frac C | -0.582 |
| Frac D | -0.870 |
| Frac E | -0.898 |
| Frac F | +0.050 |
| Frac G | +0.613 |
| Frac H | -0.295 |
| Frac I | -0.900 |
| Frac K | -0.814 |
| Frac L | +0.055 |
| Frac M | +0.727 |
| Frac N | -0.017 |
| Frac P | +0.330 |
| Frac Q | -0.536 |
| Frac R | -1.004 |
| Frac S | +0.624 |
| Frac T | +1.776 |
| Frac V | +2.011 |
| Frac W | -0.508 |
| Frac Y | +2.083 |
| Frac K+R | -1.276 |
| Frac D+E | -1.104 |
| Frac Polar | +1.154 |
| Frac Aliphatic | +0.347 |
| Frac Aromatic | +1.135 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | -1.710 |
| FCR | -1.666 |
| NCPR | -0.005 |
| Hydrophobicity | +1.712 |
| Disorder Promoting | -1.341 |
| Iso point | -0.675 |
| PPII | -0.378 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.063 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.546 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |