PLCE1 PLCE1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 17
Residues 17–68 · 51 aa
(2.2% of protein) · Min inter-cluster distance: 1.662
Weak positive charge
Sequence
KVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISQLNKLKEEPSGSN
Top exceptional features (|z-score| rank)
Frac I: +2.07Frac V: +1.55Frac S: +1.36Frac P: -1.33Frac Aromatic: -1.12hyd-pos: -1.11PPII: -1.03neg-neg: +1.01
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.485 |
| pol-hyd | -0.890 |
| pol-pos | +0.273 |
| pol-neg | +0.029 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.370 |
| hyd-pos | -1.108 |
| hyd-neg | +0.785 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.402 |
| pos-neg | +0.203 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.007 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.019 |
| Frac C | -0.582 |
| Frac D | -0.290 |
| Frac E | +0.119 |
| Frac F | -0.807 |
| Frac G | -0.713 |
| Frac H | +0.586 |
| Frac I | +2.066 |
| Frac K | +0.658 |
| Frac L | -0.558 |
| Frac M | -0.832 |
| Frac N | +0.898 |
| Frac P | -1.326 |
| Frac Q | -0.339 |
| Frac R | -0.527 |
| Frac S | +1.359 |
| Frac T | +0.036 |
| Frac V | +1.555 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.139 |
| Frac D+E | -0.047 |
| Frac Polar | +0.672 |
| Frac Aliphatic | +0.798 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.881 |
| FCR | +0.055 |
| NCPR | +0.127 |
| Hydrophobicity | +0.448 |
| Disorder Promoting | -0.668 |
| Iso point | +0.401 |
| PPII | -1.034 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 25
Residues 1051–1195 · 144 aa
(6.3% of protein) · Min inter-cluster distance: 10.265
Blocks of positive residues
Sequence
RRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANPPNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGR
Top exceptional features (|z-score| rank)
pos-pos: +2.21Frac N: +1.46Frac W: +1.39Iso point: +0.94pol-pol: -0.92Frac I: +0.85Frac S: +0.83Frac F: -0.81
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.916 |
| pol-hyd | -0.015 |
| pol-pos | +0.749 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.468 |
| hyd-pos | +0.771 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +2.206 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.109 |
| Frac C | -0.109 |
| Frac D | -0.566 |
| Frac E | -0.415 |
| Frac F | -0.807 |
| Frac G | -0.449 |
| Frac H | -0.087 |
| Frac I | +0.850 |
| Frac K | +0.274 |
| Frac L | -0.487 |
| Frac M | +0.597 |
| Frac N | +1.461 |
| Frac P | -0.323 |
| Frac Q | -0.746 |
| Frac R | +0.348 |
| Frac S | +0.832 |
| Frac T | +0.118 |
| Frac V | -0.296 |
| Frac W | +1.388 |
| Frac Y | -0.609 |
| Frac K+R | +0.436 |
| Frac D+E | -0.588 |
| Frac Polar | +0.403 |
| Frac Aliphatic | +0.151 |
| Frac Aromatic | -0.346 |
| R/K Ratio | -0.049 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.414 |
| FCR | -0.157 |
| NCPR | +0.732 |
| Hydrophobicity | -0.064 |
| Disorder Promoting | -0.683 |
| Iso point | +0.939 |
| PPII | -0.344 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.254 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +0.435 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.014 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.696 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 7
Residues 1559–1613 · 54 aa
(2.3% of protein) · Min inter-cluster distance: 18.576
D/E-tracts
Sequence
ASMQVQAYNGGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCND
Top exceptional features (|z-score| rank)
neg-neg: +5.08D Patch: +5.06pol-neg: +4.02Frac Y: +3.78Frac N: +3.76Disorder Promoting: -2.43Frac D: +2.33NCPR: -2.29
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.418 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +4.018 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +5.075 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.061 |
| Frac C | +0.681 |
| Frac D | +2.332 |
| Frac E | +1.429 |
| Frac F | -0.807 |
| Frac G | -0.749 |
| Frac H | -0.849 |
| Frac I | +0.033 |
| Frac K | -0.754 |
| Frac L | -0.620 |
| Frac M | +0.121 |
| Frac N | +3.763 |
| Frac P | -0.816 |
| Frac Q | -0.387 |
| Frac R | -0.570 |
| Frac S | -0.764 |
| Frac T | -1.284 |
| Frac V | -0.634 |
| Frac W | -0.508 |
| Frac Y | +3.778 |
| Frac K+R | -0.942 |
| Frac D+E | +2.210 |
| Frac Polar | -0.668 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | +1.637 |
| R/K Ratio | +0.294 |
| E/D Ratio | -0.297 |
| Frac Chain Expanding | +0.640 |
| FCR | +1.046 |
| NCPR | -2.291 |
| Hydrophobicity | -1.550 |
| Disorder Promoting | -2.430 |
| Iso point | -1.280 |
| PPII | -0.817 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +5.062 |
| E Patch | +2.062 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 17
Residues 1680–1744 · 64 aa
(2.8% of protein) · Min inter-cluster distance: 0.135
Weak positive charge
Sequence
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPTTS
Top exceptional features (|z-score| rank)
E/D Ratio: +1.82Frac S: +1.64Frac Polar: +1.61Frac Aliphatic: -1.58gly-gly: -1.57pol-gly: -1.55Frac N: +1.52Frac V: -1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.746 |
| pol-hyd | +0.000 |
| pol-pos | -0.541 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | -1.551 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.597 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.188 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -1.569 |
| Frac A | -0.847 |
| Frac C | +0.483 |
| Frac D | -1.234 |
| Frac E | -0.180 |
| Frac F | +0.960 |
| Frac G | +0.421 |
| Frac H | -0.849 |
| Frac I | +0.675 |
| Frac K | +0.304 |
| Frac L | -0.786 |
| Frac M | -0.028 |
| Frac N | +1.517 |
| Frac P | -0.717 |
| Frac Q | -0.861 |
| Frac R | +0.245 |
| Frac S | +1.639 |
| Frac T | +0.820 |
| Frac V | -1.311 |
| Frac W | +0.914 |
| Frac Y | -0.609 |
| Frac K+R | +0.390 |
| Frac D+E | -0.728 |
| Frac Polar | +1.615 |
| Frac Aliphatic | -1.576 |
| Frac Aromatic | +0.624 |
| R/K Ratio | -0.133 |
| E/D Ratio | +1.822 |
| Frac Chain Expanding | -0.853 |
| FCR | -0.292 |
| NCPR | +0.807 |
| Hydrophobicity | -0.237 |
| Disorder Promoting | -0.371 |
| Iso point | +0.939 |
| PPII | -1.156 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 25
Residues 2255–2302 · 47 aa
(2.0% of protein) · Min inter-cluster distance: 4.82
Blocks of positive residues
Sequence
LKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSSSDTMDYRQ
Top exceptional features (|z-score| rank)
K Patch: +3.12Frac L: +1.98Frac T: +1.58Frac A: -1.42hyd-hyd: -1.36pos-pos: +1.29Frac K: +1.18pol-pos: +1.08
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.447 |
| pol-hyd | -0.677 |
| pol-pos | +1.078 |
| pol-neg | -0.012 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.359 |
| hyd-pos | +0.070 |
| hyd-neg | -0.448 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.290 |
| pos-neg | +0.135 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.055 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | -0.210 |
| Frac E | -0.395 |
| Frac F | -0.807 |
| Frac G | -0.315 |
| Frac H | -0.849 |
| Frac I | +0.172 |
| Frac K | +1.184 |
| Frac L | +1.976 |
| Frac M | +0.263 |
| Frac N | -0.989 |
| Frac P | -0.698 |
| Frac Q | +0.678 |
| Frac R | -0.461 |
| Frac S | +0.677 |
| Frac T | +1.580 |
| Frac V | -0.534 |
| Frac W | -0.508 |
| Frac Y | +0.651 |
| Frac K+R | +0.575 |
| Frac D+E | -0.403 |
| Frac Polar | +0.631 |
| Frac Aliphatic | -0.237 |
| Frac Aromatic | -0.330 |
| R/K Ratio | -1.027 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | -0.412 |
| FCR | +0.073 |
| NCPR | +0.683 |
| Hydrophobicity | +0.130 |
| Disorder Promoting | -0.264 |
| Iso point | +0.738 |
| PPII | -0.374 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +3.121 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |