ROBO2 ROBO2
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 25
Residues 1030–1108 · 78 aa
(5.7% of protein) · Min inter-cluster distance: 1.077
Blocks of positive residues
Sequence
MGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELEHYAVEQQENGYDSDSWCPPL
Top exceptional features (|z-score| rank)
pos-pro: +5.19pro-gly: +4.05hyd-pos: +3.68Frac N: +2.71R/K Ratio: -2.56pol-pro: +2.21Disorder Promoting: -2.20hyd-pro: -2.04
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.309 |
| pol-hyd | +1.431 |
| pol-pos | +0.151 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.209 |
| pol-gly | +0.699 |
| hyd-hyd | -0.270 |
| hyd-pos | +3.684 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -2.044 |
| hyd-gly | +1.567 |
| pos-pos | +1.194 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +5.193 |
| pos-gly | +0.937 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.854 |
| pro-gly | +4.050 |
| gly-gly | +0.912 |
| Frac A | -0.950 |
| Frac C | +0.292 |
| Frac D | -0.309 |
| Frac E | -0.583 |
| Frac F | -0.082 |
| Frac G | +0.726 |
| Frac H | -0.380 |
| Frac I | -0.900 |
| Frac K | +0.966 |
| Frac L | +0.155 |
| Frac M | -0.172 |
| Frac N | +2.712 |
| Frac P | +0.396 |
| Frac Q | +0.212 |
| Frac R | -1.304 |
| Frac S | -0.721 |
| Frac T | -0.709 |
| Frac V | +0.094 |
| Frac W | +1.825 |
| Frac Y | +1.669 |
| Frac K+R | -0.150 |
| Frac D+E | -0.594 |
| Frac Polar | +0.524 |
| Frac Aliphatic | -1.060 |
| Frac Aromatic | +1.743 |
| R/K Ratio | -2.561 |
| E/D Ratio | -0.267 |
| Frac Chain Expanding | -0.354 |
| FCR | -0.546 |
| NCPR | +0.350 |
| Hydrophobicity | -0.505 |
| Disorder Promoting | -2.199 |
| Iso point | +0.536 |
| PPII | +0.231 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +0.877 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | +2.034 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.115 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 13
Residues 1114–1164 · 50 aa
(3.6% of protein) · Min inter-cluster distance: 9.885
Blocks of negative, P, & polar residues
Sequence
HQGLEDELEEDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPM
Top exceptional features (|z-score| rank)
pol-neg: +5.58neg-pro: +5.04neg-neg: +3.50hyd-hyd: -1.89pol-pol: +1.78E Patch: +1.39R/K Ratio: +1.33Frac M: +1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.782 |
| pol-hyd | +0.419 |
| pol-pos | +0.000 |
| pol-neg | +5.582 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.733 |
| pol-gly | +0.000 |
| hyd-hyd | -1.893 |
| hyd-pos | +0.000 |
| hyd-neg | +0.668 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.148 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +3.504 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +5.036 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.951 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.320 |
| Frac C | -0.582 |
| Frac D | +0.691 |
| Frac E | +0.449 |
| Frac F | +0.324 |
| Frac G | -0.377 |
| Frac H | -0.118 |
| Frac I | +0.108 |
| Frac K | -1.083 |
| Frac L | +0.038 |
| Frac M | +1.226 |
| Frac N | -0.989 |
| Frac P | +0.382 |
| Frac Q | +0.564 |
| Frac R | -0.115 |
| Frac S | -0.375 |
| Frac T | +0.511 |
| Frac V | +0.881 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.883 |
| Frac D+E | +0.675 |
| Frac Polar | -0.420 |
| Frac Aliphatic | +0.555 |
| Frac Aromatic | -0.377 |
| R/K Ratio | +1.328 |
| E/D Ratio | -0.117 |
| Frac Chain Expanding | +0.190 |
| FCR | -0.070 |
| NCPR | -1.092 |
| Hydrophobicity | +0.440 |
| Disorder Promoting | -0.034 |
| Iso point | -1.112 |
| PPII | +0.458 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.387 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 13
Residues 1184–1378 · 194 aa
(14.1% of protein) · Min inter-cluster distance: 10.619
Blocks of negative, P, & polar residues
Sequence
WHIQSNNQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL
Top exceptional features (|z-score| rank)
neg-pro: +6.70pol-neg: +4.93pol-hyd: +3.09pol-pro: +2.59pro-pro: +2.49pol-pol: +2.26neg-neg: +1.94hyd-pro: +1.40
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +2.258 |
| pol-hyd | +3.091 |
| pol-pos | +0.000 |
| pol-neg | +4.928 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.592 |
| pol-gly | +0.000 |
| hyd-hyd | +1.362 |
| hyd-pos | +0.000 |
| hyd-neg | -0.139 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.404 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.938 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +6.695 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +2.493 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.191 |
| Frac C | -0.582 |
| Frac D | +0.627 |
| Frac E | -0.579 |
| Frac F | +0.359 |
| Frac G | +0.070 |
| Frac H | +0.094 |
| Frac I | +0.139 |
| Frac K | -0.442 |
| Frac L | +0.386 |
| Frac M | +0.229 |
| Frac N | +0.003 |
| Frac P | -0.068 |
| Frac Q | +0.163 |
| Frac R | -0.078 |
| Frac S | +0.212 |
| Frac T | +0.220 |
| Frac V | -0.181 |
| Frac W | -0.039 |
| Frac Y | +0.307 |
| Frac K+R | -0.381 |
| Frac D+E | -0.144 |
| Frac Polar | +0.292 |
| Frac Aliphatic | +0.087 |
| Frac Aromatic | +0.414 |
| R/K Ratio | +0.379 |
| E/D Ratio | -1.064 |
| Frac Chain Expanding | -0.467 |
| FCR | -0.358 |
| NCPR | -0.142 |
| Hydrophobicity | +0.295 |
| Disorder Promoting | -0.331 |
| Iso point | -0.675 |
| PPII | -0.349 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +1.281 |
| E Patch | +0.099 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.010 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.101 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |