RPGRIP1L FTM
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 15
Residues 0–45 · 45 aa
(3.4% of protein) · Min inter-cluster distance: 4.246
T patches
Sequence
MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRV
Top exceptional features (|z-score| rank)
T Patch: +3.89Frac M: +2.60Frac T: +2.21pol-gly: +1.93pos-gly: +1.89hyd-gly: -1.53PPII: -1.27Hydrophobicity: +1.26
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.464 |
| pol-hyd | +0.766 |
| pol-pos | -0.321 |
| pol-neg | -0.052 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +1.927 |
| hyd-hyd | -0.021 |
| hyd-pos | -0.837 |
| hyd-neg | -0.065 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | -1.533 |
| pos-pos | +0.733 |
| pos-neg | +1.205 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +1.894 |
| neg-neg | +0.360 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.150 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.112 |
| Frac A | -0.605 |
| Frac C | -0.582 |
| Frac D | +0.370 |
| Frac E | -0.686 |
| Frac F | +0.450 |
| Frac G | +0.809 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.294 |
| Frac L | +0.865 |
| Frac M | +2.598 |
| Frac N | -0.276 |
| Frac P | -0.973 |
| Frac Q | -0.223 |
| Frac R | +0.018 |
| Frac S | -0.542 |
| Frac T | +2.206 |
| Frac V | +1.125 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.207 |
| Frac D+E | -0.348 |
| Frac Polar | +0.608 |
| Frac Aliphatic | +0.990 |
| Frac Aromatic | -0.295 |
| R/K Ratio | +0.170 |
| E/D Ratio | -0.948 |
| Frac Chain Expanding | -1.158 |
| FCR | -0.398 |
| NCPR | +0.127 |
| Hydrophobicity | +1.261 |
| Disorder Promoting | -1.232 |
| Iso point | -0.137 |
| PPII | -1.274 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | +3.887 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 28
Residues 139–173 · 34 aa
(2.6% of protein) · Min inter-cluster distance: 3.269
High aromatic fraction, specifically Ys
Sequence
LQTQGYRQTPYNNVQSRINTGRRKANENAGLQEC
Top exceptional features (|z-score| rank)
Frac N: +3.73Frac Y: +2.88Disorder Promoting: -2.78Frac Q: +2.05pol-hyd: -1.60Frac Chain Expanding: -1.48Frac Polar: +1.44Frac S: -1.43
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.510 |
| pol-hyd | -1.601 |
| pol-pos | -0.499 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.535 |
| hyd-pos | +1.125 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.183 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.341 |
| Frac C | +1.424 |
| Frac D | -1.234 |
| Frac E | -0.470 |
| Frac F | -0.807 |
| Frac G | +0.079 |
| Frac H | -0.849 |
| Frac I | +0.583 |
| Frac K | -0.561 |
| Frac L | +0.004 |
| Frac M | -0.832 |
| Frac N | +3.728 |
| Frac P | -1.186 |
| Frac Q | +2.050 |
| Frac R | +1.029 |
| Frac S | -1.433 |
| Frac T | +0.696 |
| Frac V | -0.236 |
| Frac W | -0.508 |
| Frac Y | +2.875 |
| Frac K+R | +0.269 |
| Frac D+E | -0.950 |
| Frac Polar | +1.443 |
| Frac Aliphatic | -0.482 |
| Frac Aromatic | +1.069 |
| R/K Ratio | +0.833 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -1.476 |
| FCR | -0.539 |
| NCPR | +0.895 |
| Hydrophobicity | -0.823 |
| Disorder Promoting | -2.782 |
| Iso point | +0.872 |
| PPII | -0.908 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 24
Residues 953–1090 · 137 aa
(10.4% of protein) · Min inter-cluster distance: 1.048
Weak negative charge
Sequence
STLVLAPRPKPRQRLTPVDKKVSFVDIMPHQSDETSPPPEDRKEISPEVEHIPEIEINMLTVPHVPKVSQEGSVDEVKENTEKMQQGKDDVSLLSEGQLAEQSLASSEDETEITEDLEPEVEEDMSASDSDDCIIPG
Top exceptional features (|z-score| rank)
Frac I: +2.04Frac V: +1.89neg-pro: +1.37E Patch: +1.34Disorder Promoting: -1.29NCPR: -1.27Frac D+E: +1.23pol-hyd: -1.08
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.449 |
| pol-hyd | -1.078 |
| pol-pos | +0.000 |
| pol-neg | -0.470 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.222 |
| pol-gly | +0.000 |
| hyd-hyd | -0.494 |
| hyd-pos | +0.000 |
| hyd-neg | -0.018 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.139 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.696 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +1.373 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.533 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.885 |
| Frac C | -0.085 |
| Frac D | +1.050 |
| Frac E | +0.950 |
| Frac F | -0.394 |
| Frac G | -0.875 |
| Frac H | -0.048 |
| Frac I | +2.044 |
| Frac K | -0.046 |
| Frac L | +0.201 |
| Frac M | +0.671 |
| Frac N | -0.521 |
| Frac P | -0.154 |
| Frac Q | -0.076 |
| Frac R | -0.725 |
| Frac S | -0.233 |
| Frac T | -0.137 |
| Frac V | +1.889 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.518 |
| Frac D+E | +1.229 |
| Frac Polar | -0.964 |
| Frac Aliphatic | +1.045 |
| Frac Aromatic | -0.851 |
| R/K Ratio | -0.753 |
| E/D Ratio | +0.037 |
| Frac Chain Expanding | +0.574 |
| FCR | +0.586 |
| NCPR | -1.271 |
| Hydrophobicity | +0.635 |
| Disorder Promoting | -1.293 |
| Iso point | -1.078 |
| PPII | +0.274 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.341 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |