SALL1 SALL1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 9
Residues 0–43 · 43 aa
(3.2% of protein) · Min inter-cluster distance: 2.222
Blocks of positive & negative residues
Sequence
MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAH
Top exceptional features (|z-score| rank)
Disorder Promoting: +1.89Hydrophobicity: -1.67Frac K+R: +1.40E/D Ratio: -1.25pro-pro: -1.20pol-pro: -1.18neg-neg: +1.08Frac Aliphatic: -1.08
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.632 |
| pol-hyd | +0.000 |
| pol-pos | -0.332 |
| pol-neg | +0.018 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.177 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.482 |
| pos-neg | +1.064 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.141 |
| pos-gly | +0.000 |
| neg-neg | +1.085 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.594 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.198 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.140 |
| Frac C | -0.582 |
| Frac D | +1.005 |
| Frac E | -0.655 |
| Frac F | +0.508 |
| Frac G | -0.595 |
| Frac H | +0.852 |
| Frac I | -0.900 |
| Frac K | +0.982 |
| Frac L | -1.015 |
| Frac M | +0.365 |
| Frac N | -0.989 |
| Frac P | +0.045 |
| Frac Q | +0.853 |
| Frac R | +1.002 |
| Frac S | -0.131 |
| Frac T | -0.240 |
| Frac V | -0.461 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +1.400 |
| Frac D+E | -0.021 |
| Frac Polar | -0.333 |
| Frac Aliphatic | -1.084 |
| Frac Aromatic | -0.256 |
| R/K Ratio | -0.133 |
| E/D Ratio | -1.245 |
| Frac Chain Expanding | +1.084 |
| FCR | +0.901 |
| NCPR | +0.937 |
| Hydrophobicity | -1.665 |
| Disorder Promoting | +1.887 |
| Iso point | +0.939 |
| PPII | +0.595 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 3
Residues 75–178 · 103 aa
(7.8% of protein) · Min inter-cluster distance: 7.287
Small negative blocks
Sequence
ENPASPPETFSPSPPPDNPDEQMNDTVNKTDQVDCSDLSEHNGLDREESMEVEAPVANKSGSGTSSGSHSSTAPSSSSSSSSSSGGGGSSSTGTSAITTSLPQ
Top exceptional features (|z-score| rank)
pol-neg: +2.79Frac S: +2.20neg-neg: +1.99pol-pro: +1.97pol-pol: +1.96S Patch: +1.93Frac Polar: +1.77pro-pro: +1.46
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.959 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +2.792 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.968 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.986 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +1.264 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.461 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.530 |
| Frac C | +0.080 |
| Frac D | +0.402 |
| Frac E | -0.187 |
| Frac F | -0.258 |
| Frac G | +0.066 |
| Frac H | -0.139 |
| Frac I | -0.411 |
| Frac K | -0.738 |
| Frac L | -0.847 |
| Frac M | +0.167 |
| Frac N | +0.879 |
| Frac P | -0.089 |
| Frac Q | -0.562 |
| Frac R | -1.112 |
| Frac S | +2.200 |
| Frac T | +0.677 |
| Frac V | +0.108 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.292 |
| Frac D+E | +0.049 |
| Frac Polar | +1.775 |
| Frac Aliphatic | -0.985 |
| Frac Aromatic | -0.761 |
| R/K Ratio | -0.561 |
| E/D Ratio | -0.408 |
| Frac Chain Expanding | -1.008 |
| FCR | -0.809 |
| NCPR | -0.887 |
| Hydrophobicity | +0.220 |
| Disorder Promoting | +0.419 |
| Iso point | -1.145 |
| PPII | -0.736 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.634 |
| F Patch | -0.012 |
| G Patch | +0.171 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.413 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.932 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 6
Residues 340–376 · 36 aa
(2.7% of protein) · Min inter-cluster distance: 3.13
S patches
Sequence
MNILAAAVTTPSSEKVASSAGASHVSNPAVSSSSSP
Top exceptional features (|z-score| rank)
Frac Aliphatic: +2.98Hydrophobicity: +2.79Frac V: +2.75Frac S: +2.71Frac Chain Expanding: -2.45Frac A: +2.15FCR: -1.84pol-ala: +1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.630 |
| pol-hyd | +0.079 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +1.310 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.666 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | -1.049 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.175 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +2.147 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.936 |
| Frac F | -0.807 |
| Frac G | -0.898 |
| Frac H | +0.167 |
| Frac I | +0.500 |
| Frac K | -0.590 |
| Frac L | -0.885 |
| Frac M | +0.597 |
| Frac N | +0.793 |
| Frac P | -0.422 |
| Frac Q | -1.207 |
| Frac R | -1.304 |
| Frac S | +2.705 |
| Frac T | -0.037 |
| Frac V | +2.749 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.309 |
| Frac D+E | -1.307 |
| Frac Polar | +0.881 |
| Frac Aliphatic | +2.984 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -2.451 |
| FCR | -1.841 |
| NCPR | +0.127 |
| Hydrophobicity | +2.788 |
| Disorder Promoting | -0.933 |
| Iso point | +0.401 |
| PPII | -0.742 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.088 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 6
Residues 573–653 · 80 aa
(6.0% of protein) · Min inter-cluster distance: 0.787
S patches
Sequence
EPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAG
Top exceptional features (|z-score| rank)
pol-neg: +1.72hyd-neg: +1.49Hydrophobicity: +1.43Frac S: +1.31Frac Q: -1.21pol-gly: +1.20Frac K+R: -1.18Frac Aromatic: -1.12
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.368 |
| pol-hyd | -0.791 |
| pol-pos | +0.000 |
| pol-neg | +1.723 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.650 |
| pol-gly | +1.202 |
| hyd-hyd | +0.517 |
| hyd-pos | +0.000 |
| hyd-neg | +1.486 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.585 |
| hyd-gly | +0.347 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.931 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.610 |
| neg-gly | -0.880 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.342 |
| pro-gly | -0.398 |
| gly-gly | +0.946 |
| Frac A | +0.414 |
| Frac C | +0.270 |
| Frac D | -0.633 |
| Frac E | -0.039 |
| Frac F | -0.807 |
| Frac G | +0.876 |
| Frac H | -0.392 |
| Frac I | +0.360 |
| Frac K | -0.639 |
| Frac L | -0.249 |
| Frac M | -0.189 |
| Frac N | -0.187 |
| Frac P | +0.524 |
| Frac Q | -1.207 |
| Frac R | -1.057 |
| Frac S | +1.311 |
| Frac T | +0.118 |
| Frac V | +0.516 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.181 |
| Frac D+E | -0.332 |
| Frac Polar | +0.785 |
| Frac Aliphatic | +0.514 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.561 |
| E/D Ratio | +0.742 |
| Frac Chain Expanding | -0.821 |
| FCR | -1.023 |
| NCPR | -0.526 |
| Hydrophobicity | +1.430 |
| Disorder Promoting | +0.415 |
| Iso point | -1.078 |
| PPII | -0.155 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.507 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 4
Residues 789–860 · 71 aa
(5.4% of protein) · Min inter-cluster distance: 2.207
Weak negative charge, high N fraction
Sequence
GGQIPNTPVPDSYSESMESDTGSFDEKNFDDLDNFSDENMEDCPEGSIPDTPKSADASQDSLSSSPLPLEM
Top exceptional features (|z-score| rank)
Frac D: +2.50S Patch: +2.06hyd-pro: -1.99NCPR: -1.83pol-pol: -1.66Frac F: +1.58hyd-hyd: -1.48Iso point: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.662 |
| pol-hyd | -1.211 |
| pol-pos | +0.000 |
| pol-neg | -0.952 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.449 |
| pol-gly | +0.000 |
| hyd-hyd | -1.477 |
| hyd-pos | +0.000 |
| hyd-neg | -0.919 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.990 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.659 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.705 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.167 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.904 |
| Frac C | +0.378 |
| Frac D | +2.495 |
| Frac E | +0.128 |
| Frac F | +1.583 |
| Frac G | -0.436 |
| Frac H | -0.849 |
| Frac I | +0.520 |
| Frac K | -0.583 |
| Frac L | -0.067 |
| Frac M | +1.342 |
| Frac N | +0.818 |
| Frac P | -0.006 |
| Frac Q | -0.583 |
| Frac R | -1.304 |
| Frac S | +0.870 |
| Frac T | -0.336 |
| Frac V | -0.796 |
| Frac W | -0.508 |
| Frac Y | +0.225 |
| Frac K+R | -1.304 |
| Frac D+E | +1.291 |
| Frac Polar | -0.024 |
| Frac Aliphatic | -0.603 |
| Frac Aromatic | +0.976 |
| R/K Ratio | -1.292 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | +0.133 |
| FCR | +0.118 |
| NCPR | -1.835 |
| Hydrophobicity | +0.183 |
| Disorder Promoting | -1.249 |
| Iso point | -1.347 |
| PPII | -0.483 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.065 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 6
Cluster 24
Residues 884–964 · 80 aa
(6.0% of protein) · Min inter-cluster distance: 1.464
Weak negative charge
Sequence
LKSVENGSIEGDVLTNDSSSVGGDMESQSAGSPAISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGLSPTP
Top exceptional features (|z-score| rank)
hyd-neg: -1.84Frac S: +1.69hyd-hyd: -1.52Iso point: -1.08Frac Chain Expanding: -1.07Frac R: -1.06Frac K+R: -1.01Frac I: +0.99
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.171 |
| pol-hyd | +0.295 |
| pol-pos | +0.000 |
| pol-neg | -0.349 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -1.517 |
| hyd-pos | +0.000 |
| hyd-neg | -1.844 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.739 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.274 |
| Frac C | -0.582 |
| Frac D | -0.332 |
| Frac E | +0.149 |
| Frac F | +0.607 |
| Frac G | -0.135 |
| Frac H | -0.392 |
| Frac I | +0.990 |
| Frac K | -0.417 |
| Frac L | -0.249 |
| Frac M | +0.455 |
| Frac N | +0.615 |
| Frac P | -0.363 |
| Frac Q | -0.100 |
| Frac R | -1.057 |
| Frac S | +1.686 |
| Frac T | -0.162 |
| Frac V | +0.516 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.015 |
| Frac D+E | -0.044 |
| Frac Polar | +0.908 |
| Frac Aliphatic | +0.310 |
| Frac Aromatic | -0.191 |
| R/K Ratio | -0.864 |
| E/D Ratio | +0.515 |
| Frac Chain Expanding | -1.074 |
| FCR | -0.698 |
| NCPR | -0.635 |
| Hydrophobicity | +0.918 |
| Disorder Promoting | -0.708 |
| Iso point | -1.078 |
| PPII | -0.625 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.366 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 7
Cluster 6
Residues 1092–1127 · 35 aa
(2.6% of protein) · Min inter-cluster distance: 0.366
S patches
Sequence
VHVSPQDSKDTPTSHVPSGPLSSSATSPVLLPALP
Top exceptional features (|z-score| rank)
Frac V: +2.87Hydrophobicity: +2.05E/D Ratio: -2.03pro-pro: -1.73Frac L: +1.59FCR: -1.58Frac S: +1.55hyd-pro: -1.54
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.693 |
| pol-hyd | +1.528 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.397 |
| pol-gly | +0.000 |
| hyd-hyd | +1.017 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -1.540 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.733 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.372 |
| Frac C | -0.582 |
| Frac D | +0.141 |
| Frac E | -1.354 |
| Frac F | -0.807 |
| Frac G | -0.885 |
| Frac H | +1.241 |
| Frac I | -0.900 |
| Frac K | -0.576 |
| Frac L | +1.593 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.233 |
| Frac Q | -0.575 |
| Frac R | -1.304 |
| Frac S | +1.552 |
| Frac T | +0.639 |
| Frac V | +2.865 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.299 |
| Frac D+E | -0.969 |
| Frac Polar | +0.451 |
| Frac Aliphatic | +1.301 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | -2.028 |
| Frac Chain Expanding | -0.966 |
| FCR | -1.580 |
| NCPR | -0.122 |
| Hydrophobicity | +2.054 |
| Disorder Promoting | -0.548 |
| Iso point | -0.271 |
| PPII | +0.711 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.456 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |