SDCCAG8 SDCG8
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 9
Residues 74–115 · 41 aa
(5.8% of protein) · Min inter-cluster distance: 1.928
Blocks of positive & negative residues
Sequence
NQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTM
Top exceptional features (|z-score| rank)
Frac M: +2.93pos-neg: +2.15Frac L: +1.81Frac G: -1.35Disorder Promoting: -1.26pol-neg: -1.16Frac Aromatic: -1.12Frac R: +1.11
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.709 |
| pol-hyd | -0.819 |
| pol-pos | +0.053 |
| pol-neg | -1.158 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.026 |
| hyd-pos | -0.227 |
| hyd-neg | +0.190 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.530 |
| pos-neg | +2.155 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.696 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.973 |
| Frac C | -0.582 |
| Frac D | -0.060 |
| Frac E | +0.479 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | +0.043 |
| Frac I | -0.900 |
| Frac K | +0.217 |
| Frac L | +1.813 |
| Frac M | +2.933 |
| Frac N | +0.576 |
| Frac P | -0.566 |
| Frac Q | +0.413 |
| Frac R | +1.114 |
| Frac S | -0.046 |
| Frac T | -0.189 |
| Frac V | -0.420 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.904 |
| Frac D+E | +0.338 |
| Frac Polar | -0.645 |
| Frac Aliphatic | +0.618 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.294 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | +0.585 |
| FCR | +0.846 |
| NCPR | +0.339 |
| Hydrophobicity | -0.762 |
| Disorder Promoting | -1.261 |
| Iso point | +0.670 |
| PPII | -0.047 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 4
Residues 182–218 · 36 aa
(5.0% of protein) · Min inter-cluster distance: 0.305
Weak negative charge, high N fraction
Sequence
GNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAAS
Top exceptional features (|z-score| rank)
Frac F: +2.33Frac W: +2.02PPII: -1.99Frac Aromatic: +1.98Frac N: +1.68Frac L: -1.68Frac Chain Expanding: -1.33neg-gly: -1.23
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.002 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | -0.160 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.282 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.092 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | -1.227 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.091 |
| Frac A | +0.109 |
| Frac C | -0.582 |
| Frac D | +0.772 |
| Frac E | -0.519 |
| Frac F | +2.335 |
| Frac G | +0.898 |
| Frac H | +1.183 |
| Frac I | +0.500 |
| Frac K | -0.096 |
| Frac L | -1.681 |
| Frac M | +0.597 |
| Frac N | +1.684 |
| Frac P | -1.210 |
| Frac Q | -1.207 |
| Frac R | -0.754 |
| Frac S | +0.208 |
| Frac T | +0.586 |
| Frac V | -0.296 |
| Frac W | +2.019 |
| Frac Y | -0.609 |
| Frac K+R | -0.574 |
| Frac D+E | -0.028 |
| Frac Polar | +1.154 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | +1.982 |
| R/K Ratio | -0.561 |
| E/D Ratio | -0.948 |
| Frac Chain Expanding | -1.327 |
| FCR | -0.398 |
| NCPR | -0.356 |
| Hydrophobicity | +0.213 |
| Disorder Promoting | -0.933 |
| Iso point | -0.675 |
| PPII | -1.989 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 17
Residues 531–568 · 37 aa
(5.2% of protein) · Min inter-cluster distance: 0.645
Weak positive charge
Sequence
EHQLHLTRQEKDSIQQSFSKEAKAQALQAQQREQELT
Top exceptional features (|z-score| rank)
Q Patch: +7.20Frac Q: +4.18A Patch: +4.06ala-ala: +2.17Frac P: -1.60pos-neg: -1.56Frac L: +1.42Frac G: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.436 |
| pol-hyd | -1.288 |
| pol-pos | -0.183 |
| pol-neg | +0.148 |
| pol-aro | +0.000 |
| pol-ala | +0.090 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.332 |
| hyd-pos | +0.412 |
| hyd-neg | +0.018 |
| hyd-aro | +0.000 |
| hyd-ala | +0.674 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.749 |
| pos-neg | -1.561 |
| pos-aro | +0.000 |
| pos-ala | -0.049 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.612 |
| neg-aro | +0.000 |
| neg-ala | +1.248 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +2.166 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.563 |
| Frac C | -0.582 |
| Frac D | -0.584 |
| Frac E | +0.677 |
| Frac F | +0.721 |
| Frac G | -1.347 |
| Frac H | +1.128 |
| Frac I | +0.462 |
| Frac K | +0.357 |
| Frac L | +1.416 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -1.604 |
| Frac Q | +4.180 |
| Frac R | -0.233 |
| Frac S | -0.659 |
| Frac T | -0.071 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.111 |
| Frac D+E | +0.239 |
| Frac Polar | +0.489 |
| Frac Aliphatic | +0.608 |
| Frac Aromatic | -0.116 |
| R/K Ratio | -0.437 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.849 |
| FCR | +0.253 |
| NCPR | -0.108 |
| Hydrophobicity | -0.794 |
| Disorder Promoting | +0.645 |
| Iso point | -0.271 |
| PPII | -0.333 |
| A Patch | +4.059 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | +7.197 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |