SIX5 SIX5
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 8
Residues 0–84 · 84 aa
(11.4% of protein) · Min inter-cluster distance: 17.881
Blocks of negative & A residues
Sequence
MATLPAEPSAGPAAGGEAVAAAAATEEEEEEARQLLQTLQAAEGEAAAAAGAGAGAAAAGAEGPGSPGVPGSPPEAASEPPTGL
Top exceptional features (|z-score| rank)
A Patch: +5.21Frac A: +4.70ala-pro: +4.16Frac Aliphatic: +3.63neg-ala: +3.56pol-ala: +3.54neg-pro: +3.17ala-ala: +3.06
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.511 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +2.050 |
| pol-aro | +0.000 |
| pol-ala | +3.543 |
| pol-pro | -0.809 |
| pol-gly | +1.276 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.615 |
| neg-aro | +0.000 |
| neg-ala | +3.558 |
| neg-pro | +3.166 |
| neg-gly | +2.869 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +3.060 |
| ala-pro | +4.157 |
| ala-gly | +0.733 |
| pro-pro | +2.333 |
| pro-gly | -0.439 |
| gly-gly | +1.370 |
| Frac A | +4.696 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | +0.972 |
| Frac F | -0.807 |
| Frac G | +1.155 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +0.024 |
| Frac M | -0.219 |
| Frac N | -0.989 |
| Frac P | +0.085 |
| Frac Q | -0.416 |
| Frac R | -1.068 |
| Frac S | -1.160 |
| Frac T | -0.215 |
| Frac V | -0.441 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.519 |
| Frac D+E | +0.154 |
| Frac Polar | -0.954 |
| Frac Aliphatic | +3.631 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.598 |
| E/D Ratio | +2.950 |
| Frac Chain Expanding | -0.966 |
| FCR | -0.879 |
| NCPR | -1.116 |
| Hydrophobicity | +2.178 |
| Disorder Promoting | +1.848 |
| Iso point | -1.347 |
| PPII | +0.021 |
| A Patch | +5.211 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +0.684 |
| F Patch | -0.012 |
| G Patch | +1.323 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.003 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 0
Residues 244–298 · 54 aa
(7.3% of protein) · Min inter-cluster distance: 9.798
Blocks of G & polar residues
Sequence
VSNWFKNRRQRDRTGAGGGAPCKSESDGNPTTEDESSRSPEDLERGAAPVSAEA
Top exceptional features (|z-score| rank)
pos-gly: +3.16neg-gly: +2.85R Patch: +2.35neg-ala: +2.10pos-ala: +1.92ala-ala: +1.49ala-gly: -1.31pol-gly: +1.25
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.245 |
| pol-hyd | +0.000 |
| pol-pos | -0.857 |
| pol-neg | -0.489 |
| pol-aro | +0.000 |
| pol-ala | +1.099 |
| pol-pro | +0.000 |
| pol-gly | +1.251 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.333 |
| pos-neg | +1.152 |
| pos-aro | +0.000 |
| pos-ala | +1.919 |
| pos-pro | +0.000 |
| pos-gly | +3.163 |
| neg-neg | +1.086 |
| neg-aro | +0.000 |
| neg-ala | +2.096 |
| neg-pro | +0.000 |
| neg-gly | +2.854 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +1.487 |
| ala-pro | +0.000 |
| ala-gly | -1.315 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.626 |
| Frac A | +0.618 |
| Frac C | +0.681 |
| Frac D | +0.549 |
| Frac E | +0.316 |
| Frac F | +0.240 |
| Frac G | +0.449 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.425 |
| Frac L | -1.150 |
| Frac M | -0.832 |
| Frac N | +0.793 |
| Frac P | -0.553 |
| Frac Q | -0.797 |
| Frac R | +0.899 |
| Frac S | +0.069 |
| Frac T | -0.037 |
| Frac V | +0.042 |
| Frac W | +1.177 |
| Frac Y | -0.609 |
| Frac K+R | +0.283 |
| Frac D+E | +0.504 |
| Frac Polar | +0.061 |
| Frac Aliphatic | -0.642 |
| Frac Aromatic | +0.257 |
| R/K Ratio | +0.760 |
| E/D Ratio | -0.117 |
| Frac Chain Expanding | +0.265 |
| FCR | +0.565 |
| NCPR | -0.195 |
| Hydrophobicity | -0.572 |
| Disorder Promoting | +0.564 |
| Iso point | -0.876 |
| PPII | -0.786 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +0.766 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | +2.352 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 2
Residues 355–418 · 63 aa
(8.5% of protein) · Min inter-cluster distance: 7.938
Blocks of negative, P, & G residues
Sequence
LGPLLLTGGGGAPPPQPSPQGASETKTSLVLDPQTGEVRLEEAQSEAPETKGAQVAAPGPALG
Top exceptional features (|z-score| rank)
L Patch: +7.71hyd-hyd: +2.31neg-pro: +2.19hyd-pro: +2.17neg-gly: +2.10Frac L: +1.96hyd-ala: +1.81Hydrophobicity: +1.56
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.189 |
| pol-hyd | +1.407 |
| pol-pos | +0.000 |
| pol-neg | -0.652 |
| pol-aro | +0.000 |
| pol-ala | +0.240 |
| pol-pro | +0.582 |
| pol-gly | +1.189 |
| hyd-hyd | +2.315 |
| hyd-pos | +0.000 |
| hyd-neg | +0.664 |
| hyd-aro | +0.000 |
| hyd-ala | +1.807 |
| hyd-pro | +2.169 |
| hyd-gly | +1.376 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.770 |
| neg-aro | +0.000 |
| neg-ala | -0.062 |
| neg-pro | +2.188 |
| neg-gly | +2.096 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.001 |
| ala-pro | +0.348 |
| ala-gly | -0.102 |
| pro-pro | +0.961 |
| pro-gly | +1.323 |
| gly-gly | +0.333 |
| Frac A | +0.910 |
| Frac C | -0.582 |
| Frac D | -0.852 |
| Frac E | +0.077 |
| Frac F | -0.807 |
| Frac G | +1.219 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.519 |
| Frac L | +1.957 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.647 |
| Frac Q | +0.550 |
| Frac R | -0.990 |
| Frac S | -0.922 |
| Frac T | +0.497 |
| Frac V | +0.429 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.047 |
| Frac D+E | -0.348 |
| Frac Polar | -0.017 |
| Frac Aliphatic | +1.560 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.561 |
| E/D Ratio | +1.104 |
| Frac Chain Expanding | -0.645 |
| FCR | -0.947 |
| NCPR | -0.426 |
| Hydrophobicity | +1.565 |
| Disorder Promoting | +0.422 |
| Iso point | -1.078 |
| PPII | +0.459 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +0.444 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | +7.714 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.783 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 1
Residues 595–652 · 57 aa
(7.7% of protein) · Min inter-cluster distance: 3.249
Blocks of P & polar residues
Sequence
PEGGLPVAPSPALPEAHALGTLSAQQPPPAAATTSSTSLPFSPDSPGLLPNFPAPPP
Top exceptional features (|z-score| rank)
P Patch: +2.86Frac P: +2.38Hydrophobicity: +2.11pol-pro: +2.06FCR: -1.87Frac L: +1.84PPII: +1.75Frac K+R: -1.68
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.856 |
| pol-hyd | +1.310 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +1.221 |
| pol-pro | +2.065 |
| pol-gly | +0.000 |
| hyd-hyd | -0.098 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.758 |
| hyd-pro | -0.084 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.191 |
| ala-pro | -0.839 |
| ala-gly | +0.000 |
| pro-pro | +1.281 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +1.477 |
| Frac C | -0.582 |
| Frac D | -0.812 |
| Frac E | -0.826 |
| Frac F | +1.177 |
| Frac G | -0.213 |
| Frac H | -0.207 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +1.837 |
| Frac M | -0.832 |
| Frac N | -0.426 |
| Frac P | +2.377 |
| Frac Q | -0.430 |
| Frac R | -1.304 |
| Frac S | -0.033 |
| Frac T | +0.291 |
| Frac V | -0.670 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | -1.021 |
| Frac Polar | -0.485 |
| Frac Aliphatic | +1.505 |
| Frac Aromatic | +0.185 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | -0.484 |
| FCR | -1.866 |
| NCPR | -0.331 |
| Hydrophobicity | +2.109 |
| Disorder Promoting | +0.092 |
| Iso point | -1.145 |
| PPII | +1.755 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +2.856 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |