IDR 1
Cluster 14
Residues 0–33 · 33 aa
(6.1% of protein) · Min inter-cluster distance: 7.408
Blocks of positive & P residues
Sequence
MARKQNRNSKELGLVPLTDDTSHAGPPGPGRAL
Top exceptional features (|z-score| rank)
pol-pro: +3.73pol-hyd: +3.20pol-gly: +3.08pos-pro: +2.24hyd-hyd: +2.23Frac L: +1.79hyd-pos: +1.78pro-gly: -1.67
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.336 |
| pol-hyd | +3.202 |
| pol-pos | +0.402 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +3.728 |
| pol-gly | +3.079 |
| hyd-hyd | +2.228 |
| hyd-pos | +1.785 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.953 |
| hyd-gly | +0.373 |
| pos-pos | +1.393 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +2.240 |
| pos-gly | +1.151 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.016 |
| pro-gly | -1.671 |
| gly-gly | +0.823 |
| Frac A | +0.248 |
| Frac C | -0.582 |
| Frac D | +0.225 |
| Frac E | -0.898 |
| Frac F | -0.807 |
| Frac G | +0.613 |
| Frac H | +0.259 |
| Frac I | -0.900 |
| Frac K | -0.007 |
| Frac L | +1.791 |
| Frac M | +0.727 |
| Frac N | +0.955 |
| Frac P | +0.115 |
| Frac Q | -0.536 |
| Frac R | +0.498 |
| Frac S | -0.965 |
| Frac T | +0.076 |
| Frac V | -0.204 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.327 |
| Frac D+E | -0.581 |
| Frac Polar | -0.187 |
| Frac Aliphatic | +1.089 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.170 |
| E/D Ratio | -1.105 |
| Frac Chain Expanding | -0.178 |
| FCR | -0.223 |
| NCPR | +0.655 |
| Hydrophobicity | +0.407 |
| Disorder Promoting | -0.796 |
| Iso point | +1.208 |
| PPII | -0.212 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |