SLC9A3R1 NHRF1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 19
Residues 111–165 · 54 aa
(15.1% of protein) · Min inter-cluster distance: 3.996
High negative fraction, specifically Es
Sequence
RAQEAPGQAEPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYG
Top exceptional features (|z-score| rank)
pos-ala: +1.91E/D Ratio: +1.44pro-pro: -1.34Frac S: -1.32Frac A: +1.30neg-pro: -1.11gly-gly: +1.05pol-neg: -0.98
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.838 |
| pol-hyd | +0.000 |
| pol-pos | -0.462 |
| pol-neg | -0.979 |
| pol-aro | +0.000 |
| pol-ala | +0.760 |
| pol-pro | -0.624 |
| pol-gly | -0.662 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.863 |
| pos-neg | -0.538 |
| pos-aro | +0.000 |
| pos-ala | +1.914 |
| pos-pro | -0.464 |
| pos-gly | +0.767 |
| neg-neg | -0.692 |
| neg-aro | +0.000 |
| neg-ala | -0.707 |
| neg-pro | -1.112 |
| neg-gly | +0.640 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.899 |
| ala-pro | -0.674 |
| ala-gly | +0.650 |
| pro-pro | -1.338 |
| pro-gly | -0.128 |
| gly-gly | +1.054 |
| Frac A | +1.298 |
| Frac C | +0.681 |
| Frac D | -0.789 |
| Frac E | +0.872 |
| Frac F | -0.807 |
| Frac G | +0.449 |
| Frac H | -0.172 |
| Frac I | -0.900 |
| Frac K | -0.096 |
| Frac L | -0.620 |
| Frac M | +0.121 |
| Frac N | +0.199 |
| Frac P | +0.235 |
| Frac Q | +0.433 |
| Frac R | +0.532 |
| Frac S | -1.319 |
| Frac T | -0.868 |
| Frac V | -0.634 |
| Frac W | -0.508 |
| Frac Y | +0.488 |
| Frac K+R | +0.283 |
| Frac D+E | +0.291 |
| Frac Polar | -0.668 |
| Frac Aliphatic | +0.265 |
| Frac Aromatic | -0.433 |
| R/K Ratio | +0.294 |
| E/D Ratio | +1.438 |
| Frac Chain Expanding | +0.640 |
| FCR | +0.404 |
| NCPR | -0.034 |
| Hydrophobicity | -0.718 |
| Disorder Promoting | +0.897 |
| Iso point | -0.406 |
| PPII | +0.586 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 25
Residues 249–358 · 109 aa
(30.4% of protein) · Min inter-cluster distance: 3.844
Blocks of positive residues
Sequence
HLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
Top exceptional features (|z-score| rank)
pol-hyd: +1.69neg-neg: -1.69pol-pol: +1.52pos-pos: +1.50pol-ala: +1.28hyd-pos: +1.20hyd-ala: -1.16Frac N: +1.07
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.524 |
| pol-hyd | +1.689 |
| pol-pos | +0.787 |
| pol-neg | -0.920 |
| pol-aro | +0.000 |
| pol-ala | +1.277 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.527 |
| hyd-pos | +1.202 |
| hyd-neg | -0.771 |
| hyd-aro | +0.000 |
| hyd-ala | -1.160 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +1.505 |
| pos-neg | +0.290 |
| pos-aro | +0.000 |
| pos-ala | +0.373 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -1.689 |
| neg-aro | +0.000 |
| neg-ala | -0.488 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.886 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.431 |
| Frac C | -0.582 |
| Frac D | +0.091 |
| Frac E | -0.113 |
| Frac F | +0.750 |
| Frac G | -1.051 |
| Frac H | -0.178 |
| Frac I | +0.487 |
| Frac K | +0.058 |
| Frac L | +0.947 |
| Frac M | +0.112 |
| Frac N | +1.071 |
| Frac P | -0.303 |
| Frac Q | -0.191 |
| Frac R | -0.213 |
| Frac S | +0.739 |
| Frac T | -0.460 |
| Frac V | -0.641 |
| Frac W | +0.327 |
| Frac Y | -0.609 |
| Frac K+R | -0.099 |
| Frac D+E | -0.043 |
| Frac Polar | -0.245 |
| Frac Aliphatic | +0.830 |
| Frac Aromatic | +0.245 |
| R/K Ratio | -0.274 |
| E/D Ratio | -0.090 |
| Frac Chain Expanding | -0.329 |
| FCR | -0.097 |
| NCPR | -0.033 |
| Hydrophobicity | +0.396 |
| Disorder Promoting | -1.056 |
| Iso point | -0.406 |
| PPII | -0.260 |
| A Patch | +0.836 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.866 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |