SMARCAL1 SMAL1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 16
Residues 0–238 · 238 aa
(24.9% of protein) · Min inter-cluster distance: 0.831
Blocks of polar residues
Sequence
MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQNFPRESCKPVSHGVIFKQQNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGISPPLAQSPPEVPKQQLLSYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQK
Top exceptional features (|z-score| rank)
E/D Ratio: +1.36pol-pol: +1.28pol-pos: +1.21Frac Q: +1.03Frac D: -0.93hyd-pos: -0.86Iso point: +0.81Frac I: +0.79
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.280 |
| pol-hyd | +0.198 |
| pol-pos | +1.213 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.527 |
| pol-gly | +0.000 |
| hyd-hyd | -0.678 |
| hyd-pos | -0.865 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.367 |
| hyd-gly | +0.000 |
| pos-pos | -0.023 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.118 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.363 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.121 |
| Frac C | -0.009 |
| Frac D | -0.931 |
| Frac E | -0.344 |
| Frac F | +0.619 |
| Frac G | -0.396 |
| Frac H | +0.534 |
| Frac I | +0.794 |
| Frac K | +0.409 |
| Frac L | +0.004 |
| Frac M | -0.183 |
| Frac N | +0.089 |
| Frac P | -0.114 |
| Frac Q | +1.026 |
| Frac R | -0.305 |
| Frac S | +0.267 |
| Frac T | -0.247 |
| Frac V | -0.390 |
| Frac W | -0.125 |
| Frac Y | -0.111 |
| Frac K+R | +0.102 |
| Frac D+E | -0.708 |
| Frac Polar | +0.451 |
| Frac Aliphatic | +0.135 |
| Frac Aromatic | +0.286 |
| R/K Ratio | -0.639 |
| E/D Ratio | +1.362 |
| Frac Chain Expanding | -0.626 |
| FCR | -0.466 |
| NCPR | +0.603 |
| Hydrophobicity | +0.127 |
| Disorder Promoting | -0.215 |
| Iso point | +0.805 |
| PPII | +0.162 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.054 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 3
Residues 898–943 · 45 aa
(4.7% of protein) · Min inter-cluster distance: 4.914
Small negative blocks
Sequence
LLEAAESFDPGSASGTSGSSSQNMGDTLDESSLTASPQKKRRFEF
Top exceptional features (|z-score| rank)
Frac F: +2.96pol-neg: +2.56S Patch: +2.03PPII: -1.48Frac S: +1.46Frac Aromatic: +1.36neg-neg: +1.33Frac V: -1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.767 |
| pol-hyd | +1.146 |
| pol-pos | +0.000 |
| pol-neg | +2.565 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.170 |
| hyd-pos | +0.000 |
| hyd-neg | -1.277 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.335 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.211 |
| Frac C | -0.582 |
| Frac D | +0.370 |
| Frac E | -0.018 |
| Frac F | +2.963 |
| Frac G | +0.090 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.294 |
| Frac L | +0.865 |
| Frac M | +0.312 |
| Frac N | -0.276 |
| Frac P | -0.973 |
| Frac Q | -0.223 |
| Frac R | -0.423 |
| Frac S | +1.457 |
| Frac T | +0.212 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.501 |
| Frac D+E | +0.163 |
| Frac Polar | +0.608 |
| Frac Aliphatic | -0.098 |
| Frac Aromatic | +1.361 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.267 |
| Frac Chain Expanding | -0.934 |
| FCR | -0.205 |
| NCPR | -0.453 |
| Hydrophobicity | +0.731 |
| Disorder Promoting | -0.034 |
| Iso point | -1.011 |
| PPII | -1.481 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.030 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |