SOX17 SOX17
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 20
Residues 35–68 · 33 aa
(8.0% of protein) · Min inter-cluster distance: 24.233
A blocks
Sequence
LSPIGDMKVKGEAPANSGAPAGAAGRAKGESRI
Top exceptional features (|z-score| rank)
A Patch: +5.19hyd-ala: +2.94Frac Aliphatic: +2.57Frac A: +2.47gly-gly: -2.43hyd-hyd: +2.21Frac I: +2.15Frac G: +1.59
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +1.064 |
| pol-hyd | +0.663 |
| pol-pos | +1.204 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +1.022 |
| pol-pro | +0.000 |
| pol-gly | -0.186 |
| hyd-hyd | +2.207 |
| hyd-pos | -0.338 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +2.944 |
| hyd-pro | +0.000 |
| hyd-gly | -0.257 |
| pos-pos | +1.046 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +1.568 |
| pos-pro | +0.000 |
| pos-gly | -0.852 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.924 |
| ala-pro | +0.000 |
| ala-gly | -1.043 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | -2.428 |
| Frac A | +2.472 |
| Frac C | -0.582 |
| Frac D | -0.505 |
| Frac E | -0.443 |
| Frac F | -0.807 |
| Frac G | +1.593 |
| Frac H | -0.849 |
| Frac I | +2.155 |
| Frac K | +0.532 |
| Frac L | -0.813 |
| Frac M | +0.727 |
| Frac N | -0.017 |
| Frac P | -0.314 |
| Frac Q | -1.207 |
| Frac R | -0.103 |
| Frac S | -0.511 |
| Frac T | -1.284 |
| Frac V | -0.204 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.327 |
| Frac D+E | -0.581 |
| Frac Polar | -0.783 |
| Frac Aliphatic | +2.572 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.437 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | -0.484 |
| FCR | -0.223 |
| NCPR | +0.655 |
| Hydrophobicity | +1.536 |
| Disorder Promoting | +0.292 |
| Iso point | +0.872 |
| PPII | -0.400 |
| A Patch | +5.189 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 27
Residues 251–287 · 36 aa
(8.7% of protein) · Min inter-cluster distance: 1.92
P patches
Sequence
SYAQVSDYAGPPEPPAGPMHPRLGPEPAGPSIPGLL
Top exceptional features (|z-score| rank)
P Patch: +5.71Frac Y: +2.68Frac P: +2.34gly-gly: -2.26PPII: +1.67pol-pro: +1.54ala-ala: -1.50Hydrophobicity: +1.44
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.318 |
| pol-hyd | -1.359 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | -0.872 |
| pol-pro | +1.539 |
| pol-gly | -0.198 |
| hyd-hyd | -0.176 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | -0.102 |
| hyd-pro | +0.759 |
| hyd-gly | -1.004 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -1.502 |
| ala-pro | -0.218 |
| ala-gly | -1.307 |
| pro-pro | +0.147 |
| pro-gly | -1.005 |
| gly-gly | -2.264 |
| Frac A | +0.618 |
| Frac C | -0.582 |
| Frac D | -0.566 |
| Frac E | -0.519 |
| Frac F | -0.807 |
| Frac G | +0.898 |
| Frac H | +0.167 |
| Frac I | +0.500 |
| Frac K | -1.083 |
| Frac L | +0.706 |
| Frac M | +0.597 |
| Frac N | -0.989 |
| Frac P | +2.336 |
| Frac Q | -0.592 |
| Frac R | -0.754 |
| Frac S | -0.625 |
| Frac T | -1.284 |
| Frac V | -0.296 |
| Frac W | -0.508 |
| Frac Y | +2.681 |
| Frac K+R | -1.309 |
| Frac D+E | -0.668 |
| Frac Polar | -1.032 |
| Frac Aliphatic | +1.171 |
| Frac Aromatic | +0.947 |
| R/K Ratio | +0.598 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | +0.078 |
| FCR | -1.360 |
| NCPR | -0.356 |
| Hydrophobicity | +1.443 |
| Disorder Promoting | -0.434 |
| Iso point | -0.944 |
| PPII | +1.666 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +5.705 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 11
Residues 302–357 · 55 aa
(13.3% of protein) · Min inter-cluster distance: 6.899
Q-tracts
Sequence
PGAGGGRGFQMQPQHQHQHQHQHHPPGPGQPSPPPEALPCRDGTDPSQPAELLGE
Top exceptional features (|z-score| rank)
H Patch: +9.53Q Patch: +6.27pol-gly: +6.10pol-pol: +4.46Frac H: +3.14pol-pro: +2.88Frac Q: +2.42pro-gly: +1.99
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +4.462 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.882 |
| pol-gly | +6.104 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.042 |
| pro-gly | +1.992 |
| gly-gly | +1.703 |
| Frac A | -0.420 |
| Frac C | +0.658 |
| Frac D | -0.359 |
| Frac E | -0.534 |
| Frac F | +0.221 |
| Frac G | +1.299 |
| Frac H | +3.142 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | -0.118 |
| Frac M | +0.104 |
| Frac N | -0.989 |
| Frac P | +1.491 |
| Frac Q | +2.417 |
| Frac R | -0.583 |
| Frac S | -1.329 |
| Frac T | -0.876 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.196 |
| Frac D+E | -0.581 |
| Frac Polar | +1.243 |
| Frac Aliphatic | -1.284 |
| Frac Aromatic | -0.445 |
| R/K Ratio | +1.025 |
| E/D Ratio | -0.182 |
| Frac Chain Expanding | -0.362 |
| FCR | -1.220 |
| NCPR | -0.348 |
| Hydrophobicity | -0.733 |
| Disorder Promoting | +1.599 |
| Iso point | -0.271 |
| PPII | +1.100 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +1.150 |
| H Patch | +9.533 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.768 |
| Q Patch | +6.274 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |