SRGAP1 SRGP1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 28
Residues 468–501 · 33 aa
(3.0% of protein) · Min inter-cluster distance: 1.863
High aromatic fraction, specifically Ys
Sequence
EGHRAEYMTTRPPNVPPKPQKHRKSRPRSQYNT
Top exceptional features (|z-score| rank)
Frac Y: +2.98Hydrophobicity: -2.26P Patch: +2.24Frac Aliphatic: -1.88NCPR: +1.71Frac R: +1.70Frac L: -1.68Frac K+R: +1.53
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.486 |
| pol-hyd | +0.000 |
| pol-pos | -0.912 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.071 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.542 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.413 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.002 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.864 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.443 |
| Frac F | -0.807 |
| Frac G | -0.857 |
| Frac H | +1.368 |
| Frac I | -0.900 |
| Frac K | +0.532 |
| Frac L | -1.681 |
| Frac M | +0.727 |
| Frac N | +0.955 |
| Frac P | +0.975 |
| Frac Q | +0.135 |
| Frac R | +1.700 |
| Frac S | -0.965 |
| Frac T | +0.756 |
| Frac V | -0.204 |
| Frac W | -0.508 |
| Frac Y | +2.980 |
| Frac K+R | +1.530 |
| Frac D+E | -0.930 |
| Frac Polar | -0.187 |
| Frac Aliphatic | -1.878 |
| Frac Aromatic | +1.135 |
| R/K Ratio | +0.294 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | +1.048 |
| FCR | +0.302 |
| NCPR | +1.710 |
| Hydrophobicity | -2.262 |
| Disorder Promoting | +0.292 |
| Iso point | +1.343 |
| PPII | +1.418 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +2.238 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 25
Residues 805–959 · 154 aa
(14.2% of protein) · Min inter-cluster distance: 6.386
Blocks of positive residues
Sequence
FSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHPDGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLASHPRGLLQNRGLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIA
Top exceptional features (|z-score| rank)
hyd-hyd: -2.02E/D Ratio: -1.69pol-pro: +1.68pol-hyd: -1.51pol-pos: +1.34pos-pro: +1.29Frac H: +1.05hyd-neg: -0.98
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.580 |
| pol-hyd | -1.513 |
| pol-pos | +1.342 |
| pol-neg | -0.630 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.676 |
| pol-gly | +0.000 |
| hyd-hyd | -2.017 |
| hyd-pos | +0.750 |
| hyd-neg | -0.977 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.885 |
| hyd-gly | +0.000 |
| pos-pos | +0.752 |
| pos-neg | +0.471 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +1.289 |
| pos-gly | +0.000 |
| neg-neg | -0.734 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.255 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.106 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.706 |
| Frac C | -0.139 |
| Frac D | +0.798 |
| Frac E | -0.866 |
| Frac F | -0.073 |
| Frac G | -0.087 |
| Frac H | +1.051 |
| Frac I | +0.409 |
| Frac K | -0.276 |
| Frac L | +0.551 |
| Frac M | -0.498 |
| Frac N | +0.469 |
| Frac P | +0.146 |
| Frac Q | -0.632 |
| Frac R | +0.756 |
| Frac S | +0.462 |
| Frac T | -0.118 |
| Frac V | -0.599 |
| Frac W | -0.508 |
| Frac Y | +0.160 |
| Frac K+R | +0.299 |
| Frac D+E | -0.282 |
| Frac Polar | +0.324 |
| Frac Aliphatic | -0.606 |
| Frac Aromatic | -0.155 |
| R/K Ratio | +0.661 |
| E/D Ratio | -1.693 |
| Frac Chain Expanding | +0.085 |
| FCR | -0.016 |
| NCPR | +0.410 |
| Hydrophobicity | -0.346 |
| Disorder Promoting | -0.174 |
| Iso point | +0.805 |
| PPII | -0.339 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.159 |
| Q Patch | -0.160 |
| R Patch | +0.360 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 16
Residues 968–1085 · 117 aa
(10.8% of protein) · Min inter-cluster distance: 1.691
Blocks of polar residues
Sequence
ALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPPQGPTDKSCTM
Top exceptional features (|z-score| rank)
pol-pol: +2.75pol-pro: +2.27pol-hyd: +1.90pos-pos: -1.52Frac Aliphatic: +1.24hyd-pos: -1.09Disorder Promoting: -1.05Hydrophobicity: +1.04
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +2.755 |
| pol-hyd | +1.904 |
| pol-pos | +0.638 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.273 |
| pol-gly | +0.000 |
| hyd-hyd | +0.634 |
| hyd-pos | -1.090 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.497 |
| hyd-gly | +0.000 |
| pos-pos | -1.522 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.064 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.607 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.009 |
| Frac C | +0.001 |
| Frac D | -0.411 |
| Frac E | -0.583 |
| Frac F | -0.324 |
| Frac G | -0.933 |
| Frac H | -0.224 |
| Frac I | -0.038 |
| Frac K | -0.020 |
| Frac L | +1.012 |
| Frac M | +0.927 |
| Frac N | +0.107 |
| Frac P | +0.578 |
| Frac Q | -0.261 |
| Frac R | -0.118 |
| Frac S | -0.080 |
| Frac T | +1.017 |
| Frac V | +0.875 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.094 |
| Frac D+E | -0.643 |
| Frac Polar | -0.317 |
| Frac Aliphatic | +1.241 |
| Frac Aromatic | -0.804 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.117 |
| Frac Chain Expanding | -0.225 |
| FCR | -0.546 |
| NCPR | +0.425 |
| Hydrophobicity | +1.038 |
| Disorder Promoting | -1.048 |
| Iso point | +0.738 |
| PPII | +0.714 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.310 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +0.098 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |