IDR 1
Cluster 5
Residues 25–142 · 117 aa
(19.3% of protein) · Min inter-cluster distance: 10.857
Blocks of positive, negative & P residues
Sequence
IGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVD
Top exceptional features (|z-score| rank)
neg-pro: +3.89pos-pro: +2.94pos-neg: +2.92neg-neg: +2.46Frac G: +1.97pro-pro: +1.95pos-ala: +1.65pol-neg: +1.57
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.365 |
| pol-hyd | +0.000 |
| pol-pos | +0.692 |
| pol-neg | +1.575 |
| pol-aro | +0.000 |
| pol-ala | +1.083 |
| pol-pro | +0.326 |
| pol-gly | -0.097 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | -0.905 |
| pos-neg | +2.916 |
| pos-aro | +0.000 |
| pos-ala | +1.646 |
| pos-pro | +2.940 |
| pos-gly | +1.063 |
| neg-neg | +2.465 |
| neg-aro | +0.000 |
| neg-ala | -0.047 |
| neg-pro | +3.889 |
| neg-gly | -1.044 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -0.477 |
| ala-pro | +0.021 |
| ala-gly | -1.065 |
| pro-pro | +1.946 |
| pro-gly | +1.267 |
| gly-gly | -0.791 |
| Frac A | +1.559 |
| Frac C | +0.583 |
| Frac D | +0.000 |
| Frac E | -0.326 |
| Frac F | -0.324 |
| Frac G | +1.970 |
| Frac H | -0.849 |
| Frac I | -0.469 |
| Frac K | -0.172 |
| Frac L | +0.033 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | -0.028 |
| Frac Q | +0.118 |
| Frac R | +0.052 |
| Frac S | -0.465 |
| Frac T | -0.900 |
| Frac V | -0.686 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.094 |
| Frac D+E | -0.250 |
| Frac Polar | +0.103 |
| Frac Aliphatic | +0.683 |
| Frac Aromatic | -0.804 |
| R/K Ratio | +0.132 |
| E/D Ratio | -0.230 |
| Frac Chain Expanding | -0.311 |
| FCR | -0.250 |
| NCPR | +0.127 |
| Hydrophobicity | +0.663 |
| Disorder Promoting | +1.563 |
| Iso point | -0.137 |
| PPII | -0.372 |
| A Patch | +0.932 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | +0.498 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +0.594 |
| Q Patch | +1.004 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |