TNXB TENX
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 1
Residues 24–65 · 41 aa
(1.0% of protein) · Min inter-cluster distance: 10.367
Blocks of P & polar residues
Sequence
PFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVE
Top exceptional features (|z-score| rank)
pro-gly: +2.65gly-gly: +2.60Frac V: +2.25hyd-pro: +2.21P Patch: +1.98pol-pro: +1.74pro-pro: +1.67FCR: -1.48
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.681 |
| pol-hyd | -0.442 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.741 |
| pol-gly | +1.173 |
| hyd-hyd | -0.755 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +2.209 |
| hyd-gly | -0.201 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.674 |
| pro-gly | +2.650 |
| gly-gly | +2.602 |
| Frac A | -0.525 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.621 |
| Frac F | +0.572 |
| Frac G | +0.625 |
| Frac H | +0.935 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | -0.284 |
| Frac M | -0.832 |
| Frac N | -0.207 |
| Frac P | +1.164 |
| Frac Q | -0.127 |
| Frac R | -0.337 |
| Frac S | +0.319 |
| Frac T | +0.358 |
| Frac V | +2.254 |
| Frac W | -0.508 |
| Frac Y | +0.836 |
| Frac K+R | -1.032 |
| Frac D+E | -1.066 |
| Frac Polar | +0.794 |
| Frac Aliphatic | -0.177 |
| Frac Aromatic | +0.695 |
| R/K Ratio | +1.025 |
| E/D Ratio | +0.898 |
| Frac Chain Expanding | -0.895 |
| FCR | -1.477 |
| NCPR | +0.127 |
| Hydrophobicity | +1.045 |
| Disorder Promoting | -0.385 |
| Iso point | +0.401 |
| PPII | +0.503 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.984 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 13
Residues 866–903 · 37 aa
(0.9% of protein) · Min inter-cluster distance: 9.33
Blocks of negative, P, & polar residues
Sequence
AVSYPASVRANTEEREEESPPRPSLSQPPRRPWGNLT
Top exceptional features (|z-score| rank)
neg-pro: +3.91hyd-neg: +3.79neg-neg: +2.19E Patch: +2.00Frac W: +1.95E/D Ratio: +1.82R/K Ratio: +1.76pol-hyd: -1.48
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.405 |
| pol-hyd | -1.483 |
| pol-pos | -0.323 |
| pol-neg | +1.216 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.482 |
| pol-gly | +0.000 |
| hyd-hyd | -0.932 |
| hyd-pos | +0.066 |
| hyd-neg | +3.789 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.696 |
| hyd-gly | +0.000 |
| pos-pos | -0.749 |
| pos-neg | +0.956 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.908 |
| pos-gly | +0.000 |
| neg-neg | +2.195 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +3.906 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.298 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.067 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | +0.677 |
| Frac F | -0.807 |
| Frac G | -0.910 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | -0.132 |
| Frac M | -0.832 |
| Frac N | +0.745 |
| Frac P | +1.079 |
| Frac Q | -0.609 |
| Frac R | +1.375 |
| Frac S | +0.152 |
| Frac T | -0.071 |
| Frac V | +0.664 |
| Frac W | +1.951 |
| Frac Y | +0.992 |
| Frac K+R | +0.111 |
| Frac D+E | -0.072 |
| Frac Polar | -0.840 |
| Frac Aliphatic | -0.274 |
| Frac Aromatic | +0.891 |
| R/K Ratio | +1.756 |
| E/D Ratio | +1.822 |
| Frac Chain Expanding | +0.792 |
| FCR | +0.019 |
| NCPR | +0.127 |
| Hydrophobicity | -0.474 |
| Disorder Promoting | -0.326 |
| Iso point | -0.137 |
| PPII | +1.087 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +1.997 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 13
Residues 1104–1157 · 53 aa
(1.2% of protein) · Min inter-cluster distance: 5.881
Blocks of negative, P, & polar residues
Sequence
PPPPPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTV
Top exceptional features (|z-score| rank)
neg-pro: +2.36Frac I: +1.95hyd-pro: +1.91Frac P: +1.88pro-pro: +1.86hyd-hyd: +1.85neg-gly: +1.80Frac Y: +1.63
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.515 |
| pol-hyd | -0.839 |
| pol-pos | +0.000 |
| pol-neg | +1.561 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.383 |
| pol-gly | -1.172 |
| hyd-hyd | +1.854 |
| hyd-pos | +0.000 |
| hyd-neg | +0.386 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.906 |
| hyd-gly | -0.437 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.223 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +2.362 |
| neg-gly | +1.803 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.859 |
| pro-gly | -0.849 |
| gly-gly | -1.515 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | +0.128 |
| Frac E | -0.220 |
| Frac F | -0.807 |
| Frac G | +1.093 |
| Frac H | -0.159 |
| Frac I | +1.954 |
| Frac K | +0.257 |
| Frac L | +0.481 |
| Frac M | +0.139 |
| Frac N | -0.989 |
| Frac P | +1.875 |
| Frac Q | -0.789 |
| Frac R | -0.930 |
| Frac S | -0.743 |
| Frac T | -0.437 |
| Frac V | +0.068 |
| Frac W | -0.508 |
| Frac Y | +1.626 |
| Frac K+R | -0.429 |
| Frac D+E | -0.107 |
| Frac Polar | -0.795 |
| Frac Aliphatic | -0.283 |
| Frac Aromatic | +0.283 |
| R/K Ratio | -1.100 |
| E/D Ratio | -0.267 |
| Frac Chain Expanding | +0.915 |
| FCR | -0.361 |
| NCPR | -0.201 |
| Hydrophobicity | +0.588 |
| Disorder Promoting | -0.509 |
| Iso point | -0.809 |
| PPII | +1.524 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.225 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 24
Residues 1425–1469 · 44 aa
(1.0% of protein) · Min inter-cluster distance: 0.648
Weak negative charge
Sequence
GPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTVTG
Top exceptional features (|z-score| rank)
E Patch: +2.28Frac V: +2.01NCPR: -1.85Frac T: +1.78Frac E: +1.72pol-pol: -1.39Frac K+R: -1.38Iso point: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.388 |
| pol-hyd | -0.076 |
| pol-pos | +0.000 |
| pol-neg | -0.528 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.317 |
| pol-gly | +0.000 |
| hyd-hyd | +0.635 |
| hyd-pos | +0.000 |
| hyd-neg | -0.358 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.993 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.565 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.559 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.237 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.169 |
| Frac C | -0.582 |
| Frac D | -0.140 |
| Frac E | +1.720 |
| Frac F | -0.807 |
| Frac G | +0.123 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -0.679 |
| Frac L | +0.923 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.653 |
| Frac Q | -0.704 |
| Frac R | -1.304 |
| Frac S | -0.852 |
| Frac T | +1.776 |
| Frac V | +2.011 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.376 |
| Frac D+E | +1.250 |
| Frac Polar | -0.634 |
| Frac Aliphatic | +0.718 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | +1.039 |
| Frac Chain Expanding | +0.512 |
| FCR | +0.040 |
| NCPR | -1.851 |
| Hydrophobicity | +0.997 |
| Disorder Promoting | +0.292 |
| Iso point | -1.347 |
| PPII | +0.688 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +2.281 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 9
Residues 1832–1864 · 32 aa
(0.7% of protein) · Min inter-cluster distance: 1.11
Blocks of positive & negative residues
Sequence
GPLTADGTTEARSAMDDTGTKRPPKPRLGEEL
Top exceptional features (|z-score| rank)
Frac T: +2.22pol-pro: +2.07neg-pro: +2.00pos-neg: +1.62pro-pro: +1.57Frac S: -1.41Disorder Promoting: +1.31Frac V: -1.31
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.087 |
| pol-hyd | +0.627 |
| pol-pos | +0.883 |
| pol-neg | -1.071 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +2.074 |
| pol-gly | -1.019 |
| hyd-hyd | -0.352 |
| hyd-pos | +0.754 |
| hyd-neg | -1.032 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.743 |
| hyd-gly | -1.109 |
| pos-pos | +0.866 |
| pos-neg | +1.621 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -1.264 |
| pos-gly | +0.487 |
| neg-neg | +0.345 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +1.997 |
| neg-gly | -1.147 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.571 |
| pro-gly | +1.042 |
| gly-gly | -1.094 |
| Frac A | +0.300 |
| Frac C | -0.582 |
| Frac D | +1.022 |
| Frac E | +0.055 |
| Frac F | -0.807 |
| Frac G | +0.674 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | +0.027 |
| Frac L | +1.005 |
| Frac M | +0.776 |
| Frac N | -0.989 |
| Frac P | +0.169 |
| Frac Q | -1.207 |
| Frac R | +0.555 |
| Frac S | -1.405 |
| Frac T | +2.222 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.390 |
| Frac D+E | +0.531 |
| Frac Polar | -0.690 |
| Frac Aliphatic | +0.208 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.170 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.886 |
| FCR | +0.655 |
| NCPR | -0.145 |
| Hydrophobicity | -0.072 |
| Disorder Promoting | +1.313 |
| Iso point | -0.809 |
| PPII | +0.017 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 6
Cluster 19
Residues 2445–2488 · 43 aa
(1.0% of protein) · Min inter-cluster distance: 1.479
High negative fraction, specifically Es
Sequence
SAIGVTEEETPSPTEPSMEAPEPPEEPLLGELTVTGSSPDSLS
Top exceptional features (|z-score| rank)
E Patch: +2.34NCPR: -1.90hyd-pro: +1.84Frac E: +1.79Iso point: -1.75Frac K+R: -1.68E/D Ratio: +1.58S Patch: +1.36
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.356 |
| pol-hyd | +0.299 |
| pol-pos | +0.000 |
| pol-neg | +0.363 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.308 |
| pol-gly | +0.000 |
| hyd-hyd | +1.002 |
| hyd-pos | +0.000 |
| hyd-neg | +0.140 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.843 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.798 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -1.020 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.169 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.567 |
| Frac C | -0.582 |
| Frac D | -0.675 |
| Frac E | +1.791 |
| Frac F | -0.807 |
| Frac G | -0.219 |
| Frac H | -0.849 |
| Frac I | +0.272 |
| Frac K | -1.083 |
| Frac L | +0.984 |
| Frac M | +0.365 |
| Frac N | -0.989 |
| Frac P | +1.035 |
| Frac Q | -1.207 |
| Frac R | -1.304 |
| Frac S | +0.566 |
| Frac T | +1.325 |
| Frac V | +0.388 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | +1.050 |
| Frac Polar | -0.333 |
| Frac Aliphatic | +0.433 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +1.579 |
| Frac Chain Expanding | +0.378 |
| FCR | -0.308 |
| NCPR | -1.897 |
| Hydrophobicity | +1.138 |
| Disorder Promoting | +0.216 |
| Iso point | -1.751 |
| PPII | +0.764 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +2.342 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.356 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.358 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 7
Cluster 27
Residues 2549–2599 · 50 aa
(1.2% of protein) · Min inter-cluster distance: 1.192
P patches
Sequence
PVSTVGVTAPQEDVDETPSPTEPGTEAPGPPEEPLLGELTVTGSSPDSLS
Top exceptional features (|z-score| rank)
Frac V: +2.34Frac T: +1.86Iso point: -1.75Frac K+R: -1.68NCPR: -1.61hyd-pro: +1.57hyd-hyd: +1.49Frac R: -1.30
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.846 |
| pol-hyd | -0.045 |
| pol-pos | +0.000 |
| pol-neg | +0.486 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.042 |
| pol-gly | +0.000 |
| hyd-hyd | +1.490 |
| hyd-pos | +0.000 |
| hyd-neg | -0.045 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.566 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.385 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.497 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.130 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.686 |
| Frac C | -0.582 |
| Frac D | +0.210 |
| Frac E | +0.750 |
| Frac F | -0.807 |
| Frac G | +0.270 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +0.611 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.233 |
| Frac Q | -0.764 |
| Frac R | -1.304 |
| Frac S | -0.075 |
| Frac T | +1.857 |
| Frac V | +2.343 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | +0.675 |
| Frac Polar | -0.026 |
| Frac Aliphatic | +0.228 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | +0.190 |
| FCR | -0.590 |
| NCPR | -1.614 |
| Hydrophobicity | +1.229 |
| Disorder Promoting | +0.325 |
| Iso point | -1.751 |
| PPII | +0.880 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.103 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.101 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 8
Cluster 13
Residues 2661–2698 · 37 aa
(0.9% of protein) · Min inter-cluster distance: 0.668
Blocks of negative, P, & polar residues
Sequence
VSAVGVTEDEAETTQAVPTMTPEPPIKPRLGELTMTD
Top exceptional features (|z-score| rank)
Frac T: +2.96Frac V: +2.64neg-pro: +2.08Frac M: +1.95Frac Aliphatic: +1.93P Patch: +1.65Hydrophobicity: +1.63Frac S: -1.47
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.525 |
| pol-hyd | -0.521 |
| pol-pos | +0.000 |
| pol-neg | +0.016 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.026 |
| pol-gly | +0.000 |
| hyd-hyd | -0.143 |
| hyd-pos | +0.000 |
| hyd-neg | +0.764 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.210 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.424 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +2.075 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +1.330 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.067 |
| Frac C | -0.582 |
| Frac D | +0.067 |
| Frac E | +0.677 |
| Frac F | -0.807 |
| Frac G | -0.473 |
| Frac H | -0.849 |
| Frac I | +0.462 |
| Frac K | -0.603 |
| Frac L | -0.132 |
| Frac M | +1.949 |
| Frac N | -0.989 |
| Frac P | +0.313 |
| Frac Q | -0.609 |
| Frac R | -0.768 |
| Frac S | -1.469 |
| Frac T | +2.961 |
| Frac V | +2.639 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.962 |
| Frac D+E | +0.550 |
| Frac Polar | -0.840 |
| Frac Aliphatic | +1.931 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +0.358 |
| Frac Chain Expanding | -0.029 |
| FCR | -0.215 |
| NCPR | -1.049 |
| Hydrophobicity | +1.628 |
| Disorder Promoting | -0.811 |
| Iso point | -1.179 |
| PPII | +0.674 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.648 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 9
Cluster 19
Residues 2771–2804 · 33 aa
(0.8% of protein) · Min inter-cluster distance: 11.185
High negative fraction, specifically Es
Sequence
GVTEEETPSPTELSTEAPEPPEEPLLGELTVTG
Top exceptional features (|z-score| rank)
E Patch: +3.16Frac T: +2.79Frac E: +2.74E/D Ratio: +2.50NCPR: -2.25hyd-pro: +2.10P Patch: +1.90Frac L: +1.79
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.382 |
| pol-hyd | +0.348 |
| pol-pos | +0.000 |
| pol-neg | -0.006 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +1.246 |
| pol-gly | +0.000 |
| hyd-hyd | +1.198 |
| hyd-pos | +0.000 |
| hyd-neg | +0.254 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +2.104 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -1.236 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.512 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.681 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.864 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | +2.744 |
| Frac F | -0.807 |
| Frac G | +0.123 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +1.791 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.975 |
| Frac Q | -1.207 |
| Frac R | -1.304 |
| Frac S | -0.965 |
| Frac T | +2.795 |
| Frac V | +0.903 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | +1.512 |
| Frac Polar | -0.485 |
| Frac Aliphatic | +0.100 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +2.502 |
| Frac Chain Expanding | +0.742 |
| FCR | +0.040 |
| NCPR | -2.247 |
| Hydrophobicity | +0.879 |
| Disorder Promoting | +0.292 |
| Iso point | -1.751 |
| PPII | +0.835 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +3.158 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.902 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 10
Cluster 19
Residues 2974–3011 · 37 aa
(0.9% of protein) · Min inter-cluster distance: 11.618
High negative fraction, specifically Es
Sequence
GVTEEETPAPTEPSTEAPEPPEEPLLGELTVTGSSPD
Top exceptional features (|z-score| rank)
E Patch: +2.78Frac T: +2.35Frac E: +2.30NCPR: -2.23hyd-pro: +2.09hyd-hyd: +2.03Iso point: -1.75Frac K+R: -1.68
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.927 |
| pol-hyd | +0.903 |
| pol-pos | +0.000 |
| pol-neg | +0.466 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.898 |
| pol-gly | +0.000 |
| hyd-hyd | +2.027 |
| hyd-pos | +0.000 |
| hyd-neg | +0.170 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +2.087 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.405 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.836 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.413 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.429 |
| Frac C | -0.582 |
| Frac D | -0.584 |
| Frac E | +2.301 |
| Frac F | -0.807 |
| Frac G | -0.036 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +0.642 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +1.463 |
| Frac Q | -1.207 |
| Frac R | -1.304 |
| Frac S | -0.659 |
| Frac T | +2.354 |
| Frac V | +0.664 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | +1.484 |
| Frac Polar | -0.574 |
| Frac Aliphatic | -0.274 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +1.579 |
| Frac Chain Expanding | +1.065 |
| FCR | +0.019 |
| NCPR | -2.226 |
| Hydrophobicity | +0.479 |
| Disorder Promoting | +1.131 |
| Iso point | -1.751 |
| PPII | +1.333 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +2.779 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.648 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 11
Cluster 27
Residues 3077–3110 · 33 aa
(0.8% of protein) · Min inter-cluster distance: 9.433
P patches
Sequence
SAVGVTAPKDEAETTQAVPTMTPEPPIKPRLGE
Top exceptional features (|z-score| rank)
Frac T: +2.12Frac V: +2.01P Patch: +1.90hyd-neg: +1.60Frac Aliphatic: +1.58PPII: +1.51ala-ala: -1.47Frac S: -1.42
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.728 |
| pol-hyd | -0.281 |
| pol-pos | +0.000 |
| pol-neg | +0.591 |
| pol-aro | +0.000 |
| pol-ala | -1.188 |
| pol-pro | +1.155 |
| pol-gly | +0.000 |
| hyd-hyd | -0.298 |
| hyd-pos | +0.000 |
| hyd-neg | +1.601 |
| hyd-aro | +0.000 |
| hyd-ala | -0.737 |
| hyd-pro | -0.618 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.923 |
| neg-aro | +0.000 |
| neg-ala | -1.040 |
| neg-pro | +0.747 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -1.470 |
| ala-pro | +1.226 |
| ala-gly | +0.000 |
| pro-pro | -0.178 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.804 |
| Frac C | -0.582 |
| Frac D | -0.505 |
| Frac E | +0.468 |
| Frac F | -0.807 |
| Frac G | -0.367 |
| Frac H | -0.849 |
| Frac I | +0.628 |
| Frac K | -0.007 |
| Frac L | -0.813 |
| Frac M | +0.727 |
| Frac N | -0.989 |
| Frac P | +0.975 |
| Frac Q | -0.536 |
| Frac R | -0.704 |
| Frac S | -1.420 |
| Frac T | +2.115 |
| Frac V | +2.011 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.474 |
| Frac D+E | +0.117 |
| Frac Polar | -1.082 |
| Frac Aliphatic | +1.583 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.561 |
| E/D Ratio | +0.656 |
| Frac Chain Expanding | +0.435 |
| FCR | -0.223 |
| NCPR | -0.400 |
| Hydrophobicity | +1.191 |
| Disorder Promoting | +0.292 |
| Iso point | -0.977 |
| PPII | +1.506 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +1.902 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 12
Cluster 19
Residues 3185–3226 · 41 aa
(1.0% of protein) · Min inter-cluster distance: 5.012
High negative fraction, specifically Es
Sequence
SAIGVTEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDS
Top exceptional features (|z-score| rank)
E Patch: +2.47hyd-hyd: +2.24Frac T: +2.00NCPR: -2.00Frac E: +1.95hyd-pro: +1.88Iso point: -1.75Frac K+R: -1.68
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.411 |
| pol-hyd | +0.886 |
| pol-pos | +0.000 |
| pol-neg | +0.333 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.446 |
| pol-gly | +0.000 |
| hyd-hyd | +2.237 |
| hyd-pos | +0.000 |
| hyd-neg | +0.571 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +1.876 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.446 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -0.999 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.036 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.078 |
| Frac C | -0.582 |
| Frac D | -0.647 |
| Frac E | +1.945 |
| Frac F | -0.807 |
| Frac G | -0.164 |
| Frac H | -0.849 |
| Frac I | +0.329 |
| Frac K | -1.083 |
| Frac L | +0.415 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.818 |
| Frac Q | -1.207 |
| Frac R | -1.304 |
| Frac S | +0.319 |
| Frac T | +1.999 |
| Frac V | +0.471 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.677 |
| Frac D+E | +1.180 |
| Frac Polar | -0.165 |
| Frac Aliphatic | +0.221 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | +1.579 |
| Frac Chain Expanding | +0.338 |
| FCR | -0.210 |
| NCPR | -1.996 |
| Hydrophobicity | +0.959 |
| Disorder Promoting | +0.930 |
| Iso point | -1.751 |
| PPII | +0.629 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +2.473 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 13
Cluster 19
Residues 3575–3605 · 30 aa
(0.7% of protein) · Min inter-cluster distance: 3.904
High negative fraction, specifically Es
Sequence
ALGMTAPEEDTPAPELAPEAPEPPEEPRLG
Top exceptional features (|z-score| rank)
E Patch: +3.51P Patch: +3.24Frac Polar: -2.45PPII: +2.29Frac P: +2.18Frac E: +2.15NCPR: -1.90Frac Chain Expanding: +1.88
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.000 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | +0.421 |
| hyd-pos | +0.000 |
| hyd-neg | +1.431 |
| hyd-aro | +0.000 |
| hyd-ala | -1.105 |
| hyd-pro | +0.992 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | -0.708 |
| neg-aro | +0.000 |
| neg-ala | +0.178 |
| neg-pro | -1.452 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -0.818 |
| ala-pro | -0.508 |
| ala-gly | +0.000 |
| pro-pro | -1.128 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +1.638 |
| Frac C | -0.582 |
| Frac D | -0.432 |
| Frac E | +2.152 |
| Frac F | -0.807 |
| Frac G | -0.269 |
| Frac H | -0.849 |
| Frac I | -0.900 |
| Frac K | -1.083 |
| Frac L | +1.184 |
| Frac M | +0.883 |
| Frac N | -0.989 |
| Frac P | +2.178 |
| Frac Q | -1.207 |
| Frac R | -0.643 |
| Frac S | -1.874 |
| Frac T | +0.212 |
| Frac V | -1.311 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -1.236 |
| Frac D+E | +1.442 |
| Frac Polar | -2.453 |
| Frac Aliphatic | +1.534 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.598 |
| E/D Ratio | +1.282 |
| Frac Chain Expanding | +1.876 |
| FCR | +0.276 |
| NCPR | -1.904 |
| Hydrophobicity | +0.545 |
| Disorder Promoting | +1.163 |
| Iso point | -1.280 |
| PPII | +2.287 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | +3.508 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +3.244 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |