WT1 WT1
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 1
Residues 44–85 · 41 aa
(9.1% of protein) · Min inter-cluster distance: 17.119
Blocks of P & polar residues
Sequence
ASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHE
Top exceptional features (|z-score| rank)
pro-gly: +5.84pro-pro: +4.91pol-pro: +4.84P Patch: +3.60Frac P: +3.58PPII: +2.99ala-pro: +2.89gly-gly: +2.14
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | +0.716 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.200 |
| pol-pro | +4.836 |
| pol-gly | +0.245 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -0.306 |
| ala-pro | +2.893 |
| ala-gly | -0.355 |
| pro-pro | +4.905 |
| pro-gly | +5.837 |
| gly-gly | +2.137 |
| Frac A | +0.817 |
| Frac C | -0.582 |
| Frac D | -1.234 |
| Frac E | -0.254 |
| Frac F | +0.572 |
| Frac G | +0.625 |
| Frac H | +0.935 |
| Frac I | +0.329 |
| Frac K | -0.650 |
| Frac L | -0.982 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +3.585 |
| Frac Q | -0.667 |
| Frac R | -1.304 |
| Frac S | -0.412 |
| Frac T | -1.284 |
| Frac V | -1.311 |
| Frac W | +1.711 |
| Frac Y | +0.836 |
| Frac K+R | -1.354 |
| Frac D+E | -0.785 |
| Frac Polar | -0.885 |
| Frac Aliphatic | -0.575 |
| Frac Aromatic | +1.604 |
| R/K Ratio | -0.864 |
| E/D Ratio | +1.282 |
| Frac Chain Expanding | +0.832 |
| FCR | -1.477 |
| NCPR | -0.297 |
| Hydrophobicity | +0.483 |
| Disorder Promoting | +1.368 |
| Iso point | -0.675 |
| PPII | +2.991 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | +3.605 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 28
Residues 154–197 · 43 aa
(9.6% of protein) · Min inter-cluster distance: 17.583
High aromatic fraction, specifically Ys
Sequence
DGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPP
Top exceptional features (|z-score| rank)
Frac H: +3.40Frac Aromatic: +2.34Frac Y: +2.15Frac F: +1.82Frac Polar: +1.50Frac Aliphatic: -1.46Frac K+R: -1.37Frac Q: +1.37
Show all 90 sequence-feature z-scores
| Feature | Z-score |
| pol-pol | -0.822 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.566 |
| pol-gly | -0.017 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.835 |
| pro-gly | -0.394 |
| gly-gly | +0.196 |
| Frac A | -0.567 |
| Frac C | -0.582 |
| Frac D | -0.115 |
| Frac E | -0.655 |
| Frac F | +1.823 |
| Frac G | +0.533 |
| Frac H | +3.405 |
| Frac I | -0.900 |
| Frac K | -0.670 |
| Frac L | -1.015 |
| Frac M | +0.365 |
| Frac N | -0.243 |
| Frac P | +0.375 |
| Frac Q | +1.368 |
| Frac R | -1.304 |
| Frac S | -0.131 |
| Frac T | -0.240 |
| Frac V | -0.461 |
| Frac W | -0.508 |
| Frac Y | +2.146 |
| Frac K+R | -1.369 |
| Frac D+E | -0.556 |
| Frac Polar | +1.497 |
| Frac Aliphatic | -1.464 |
| Frac Aromatic | +2.343 |
| R/K Ratio | -0.864 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -1.268 |
| FCR | -1.315 |
| NCPR | -0.480 |
| Hydrophobicity | -0.437 |
| Disorder Promoting | +0.216 |
| Iso point | -0.338 |
| PPII | -0.199 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |