ZNF423 ZN423
IDR map — colored by GIN molecular grammar cluster
IDR 1
Cluster 7
Residues 0–69 · 69 aa
(5.4% of protein) · Min inter-cluster distance: 12.212
D/E-tracts
Sequence
MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTC
Top exceptional features (|z-score| rank)
D Patch: +3.01hyd-hyd: -2.56pos-neg: +2.44E Patch: +2.38pol-neg: +2.24Frac D+E: +1.88NCPR: -1.64neg-neg: +1.60
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +1.454 |
| pol-hyd | -0.884 |
| pol-pos | +0.140 |
| pol-neg | +2.244 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -2.558 |
| hyd-pos | -0.991 |
| hyd-neg | +0.451 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.651 |
| pos-neg | +2.442 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +1.603 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.091 |
| Frac C | +1.395 |
| Frac D | +1.557 |
| Frac E | +1.477 |
| Frac F | +0.013 |
| Frac G | -0.410 |
| Frac H | -0.319 |
| Frac I | -0.170 |
| Frac K | -0.311 |
| Frac L | -0.435 |
| Frac M | +0.660 |
| Frac N | -0.059 |
| Frac P | -1.398 |
| Frac Q | -0.565 |
| Frac R | -0.155 |
| Frac S | -0.136 |
| Frac T | +0.017 |
| Frac V | +0.278 |
| Frac W | +0.811 |
| Frac Y | +0.249 |
| Frac K+R | -0.335 |
| Frac D+E | +1.876 |
| Frac Polar | -0.485 |
| Frac Aliphatic | -0.051 |
| Frac Aromatic | +0.497 |
| R/K Ratio | +0.102 |
| E/D Ratio | +0.024 |
| Frac Chain Expanding | +0.395 |
| FCR | +1.192 |
| NCPR | -1.639 |
| Hydrophobicity | -0.342 |
| Disorder Promoting | -0.607 |
| Iso point | -1.112 |
| PPII | -1.292 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +3.012 |
| E Patch | +2.376 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 2
Cluster 3
Residues 82–117 · 35 aa
(2.7% of protein) · Min inter-cluster distance: 8.739
Small negative blocks
Sequence
TDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQ
Top exceptional features (|z-score| rank)
D Patch: +4.31E/D Ratio: -3.16Frac D: +2.89Frac W: +2.09pol-pro: -1.80pro-pro: -1.54Frac C: +1.37Frac E: -1.35
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.538 |
| pol-hyd | +0.000 |
| pol-pos | +0.000 |
| pol-neg | +1.284 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -1.801 |
| pol-gly | +0.000 |
| hyd-hyd | +0.000 |
| hyd-pos | +0.000 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.940 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.226 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -1.544 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.152 |
| Frac C | +1.366 |
| Frac D | +2.892 |
| Frac E | -1.354 |
| Frac F | -0.807 |
| Frac G | -0.423 |
| Frac H | +1.241 |
| Frac I | -0.900 |
| Frac K | -0.576 |
| Frac L | -0.862 |
| Frac M | -0.832 |
| Frac N | -0.989 |
| Frac P | +0.017 |
| Frac Q | +0.058 |
| Frac R | -0.171 |
| Frac S | +0.695 |
| Frac T | -0.002 |
| Frac V | +0.777 |
| Frac W | +2.091 |
| Frac Y | -0.609 |
| Frac K+R | -0.543 |
| Frac D+E | +0.346 |
| Frac Polar | +0.451 |
| Frac Aliphatic | -0.564 |
| Frac Aromatic | -0.058 |
| R/K Ratio | +0.294 |
| E/D Ratio | -3.156 |
| Frac Chain Expanding | -0.099 |
| FCR | -0.095 |
| NCPR | -0.619 |
| Hydrophobicity | -0.212 |
| Disorder Promoting | +0.992 |
| Iso point | -0.876 |
| PPII | -0.359 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | +4.313 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.133 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 3
Cluster 6
Residues 342–400 · 58 aa
(4.5% of protein) · Min inter-cluster distance: 0.272
S patches
Sequence
DSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDD
Top exceptional features (|z-score| rank)
E/D Ratio: -2.41S Patch: +2.25pol-pos: +1.83neg-pro: -1.78Frac S: +1.74Frac D: +1.67pos-pos: +1.34Frac V: +1.21
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | +0.725 |
| pol-hyd | +0.545 |
| pol-pos | +1.828 |
| pol-neg | +0.011 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | -0.103 |
| pol-gly | +0.000 |
| hyd-hyd | -0.517 |
| hyd-pos | -0.074 |
| hyd-neg | -0.227 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.557 |
| hyd-gly | +0.000 |
| pos-pos | +1.337 |
| pos-neg | -0.136 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +1.061 |
| pos-gly | +0.000 |
| neg-neg | -0.988 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | -1.783 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.718 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -0.471 |
| Frac C | -0.582 |
| Frac D | +1.671 |
| Frac E | -1.095 |
| Frac F | -0.807 |
| Frac G | -0.511 |
| Frac H | +0.412 |
| Frac I | -0.900 |
| Frac K | -0.164 |
| Frac L | -0.199 |
| Frac M | +0.942 |
| Frac N | -0.436 |
| Frac P | -0.137 |
| Frac Q | -0.444 |
| Frac R | +0.063 |
| Frac S | +1.744 |
| Frac T | -0.123 |
| Frac V | +1.209 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.080 |
| Frac D+E | -0.040 |
| Frac Polar | +0.476 |
| Frac Aliphatic | +0.015 |
| Frac Aromatic | -1.123 |
| R/K Ratio | +0.102 |
| E/D Ratio | -2.411 |
| Frac Chain Expanding | -0.193 |
| FCR | -0.082 |
| NCPR | -0.023 |
| Hydrophobicity | +0.070 |
| Disorder Promoting | +0.461 |
| Iso point | -0.271 |
| PPII | -0.424 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +2.246 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 4
Cluster 25
Residues 588–629 · 41 aa
(3.2% of protein) · Min inter-cluster distance: 5.7
Blocks of positive residues
Sequence
KNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISN
Top exceptional features (|z-score| rank)
Frac S: +2.15pos-pos: +2.04S Patch: +1.72hyd-pos: +1.62Frac I: +1.56pol-hyd: -1.36Frac V: +1.36Frac N: +1.36
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -1.161 |
| pol-hyd | -1.362 |
| pol-pos | -0.166 |
| pol-neg | +0.000 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.000 |
| pol-gly | +0.000 |
| hyd-hyd | -0.219 |
| hyd-pos | +1.622 |
| hyd-neg | +0.000 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | +0.000 |
| hyd-gly | +0.000 |
| pos-pos | +2.045 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.000 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.000 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | +0.000 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +0.370 |
| Frac C | -0.582 |
| Frac D | -0.647 |
| Frac E | -0.621 |
| Frac F | -0.807 |
| Frac G | -1.347 |
| Frac H | +0.043 |
| Frac I | +1.559 |
| Frac K | +1.083 |
| Frac L | -0.284 |
| Frac M | -0.832 |
| Frac N | +1.358 |
| Frac P | -0.566 |
| Frac Q | -0.127 |
| Frac R | -0.337 |
| Frac S | +2.147 |
| Frac T | -1.284 |
| Frac V | +1.362 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.582 |
| Frac D+E | -0.785 |
| Frac Polar | +0.314 |
| Frac Aliphatic | +1.016 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.864 |
| E/D Ratio | -0.025 |
| Frac Chain Expanding | -0.649 |
| FCR | -0.210 |
| NCPR | +0.976 |
| Hydrophobicity | +0.414 |
| Disorder Promoting | -0.823 |
| Iso point | +0.939 |
| PPII | -0.133 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | +1.724 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 5
Cluster 13
Residues 838–881 · 43 aa
(3.3% of protein) · Min inter-cluster distance: 0.313
Blocks of negative, P, & polar residues
Sequence
NGTANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDA
Top exceptional features (|z-score| rank)
Frac N: +2.00Frac Aliphatic: +1.95hyd-neg: +1.80R/K Ratio: -1.59Frac A: +1.57Frac M: +1.56neg-pro: +1.54ala-ala: -1.40
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.318 |
| pol-hyd | +0.932 |
| pol-pos | +0.000 |
| pol-neg | +0.506 |
| pol-aro | +0.000 |
| pol-ala | -1.145 |
| pol-pro | -0.062 |
| pol-gly | +0.000 |
| hyd-hyd | +0.837 |
| hyd-pos | +0.000 |
| hyd-neg | +1.801 |
| hyd-aro | +0.000 |
| hyd-ala | +1.259 |
| hyd-pro | +0.811 |
| hyd-gly | +0.000 |
| pos-pos | +0.000 |
| pos-neg | +0.000 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | +0.000 |
| pos-gly | +0.000 |
| neg-neg | +0.902 |
| neg-aro | +0.000 |
| neg-ala | -0.443 |
| neg-pro | +1.544 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | -1.400 |
| ala-pro | -1.069 |
| ala-gly | +0.000 |
| pro-pro | +0.691 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | +1.567 |
| Frac C | -0.582 |
| Frac D | +1.005 |
| Frac E | +0.044 |
| Frac F | -0.807 |
| Frac G | -0.219 |
| Frac H | +0.002 |
| Frac I | -0.900 |
| Frac K | +0.156 |
| Frac L | +0.318 |
| Frac M | +1.561 |
| Frac N | +1.995 |
| Frac P | +0.045 |
| Frac Q | -0.692 |
| Frac R | -1.304 |
| Frac S | -1.177 |
| Frac T | -0.240 |
| Frac V | +0.388 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | -0.754 |
| Frac D+E | +0.514 |
| Frac Polar | -0.790 |
| Frac Aliphatic | +1.951 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -1.595 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | -0.092 |
| FCR | -0.107 |
| NCPR | -0.885 |
| Hydrophobicity | +0.531 |
| Disorder Promoting | -1.037 |
| Iso point | -1.045 |
| PPII | +0.143 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |
IDR 6
Cluster 25
Residues 1132–1166 · 34 aa
(2.6% of protein) · Min inter-cluster distance: 1.867
Blocks of positive residues
Sequence
EDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKK
Top exceptional features (|z-score| rank)
pol-pos: +1.99pos-pos: +1.62Frac A: -1.42hyd-neg: -1.39Frac T: +1.36Frac H: +1.30Frac Aromatic: -1.12Hydrophobicity: -1.10
Show all 90 sequence-feature z-scores
| Feature | Z-score |
|---|
| pol-pol | -0.319 |
| pol-hyd | +0.255 |
| pol-pos | +1.987 |
| pol-neg | +0.532 |
| pol-aro | +0.000 |
| pol-ala | +0.000 |
| pol-pro | +0.374 |
| pol-gly | +0.000 |
| hyd-hyd | -0.548 |
| hyd-pos | +0.196 |
| hyd-neg | -1.393 |
| hyd-aro | +0.000 |
| hyd-ala | +0.000 |
| hyd-pro | -0.113 |
| hyd-gly | +0.000 |
| pos-pos | +1.625 |
| pos-neg | +0.842 |
| pos-aro | +0.000 |
| pos-ala | +0.000 |
| pos-pro | -0.994 |
| pos-gly | +0.000 |
| neg-neg | +0.893 |
| neg-aro | +0.000 |
| neg-ala | +0.000 |
| neg-pro | +0.526 |
| neg-gly | +0.000 |
| aro-aro | +0.000 |
| aro-ala | +0.000 |
| aro-pro | +0.000 |
| aro-gly | +0.000 |
| ala-ala | +0.000 |
| ala-pro | +0.000 |
| ala-gly | +0.000 |
| pro-pro | -0.174 |
| pro-gly | +0.000 |
| gly-gly | +0.000 |
| Frac A | -1.420 |
| Frac C | -0.582 |
| Frac D | +0.890 |
| Frac E | -0.028 |
| Frac F | -0.807 |
| Frac G | -0.396 |
| Frac H | +1.303 |
| Frac I | -0.900 |
| Frac K | +0.484 |
| Frac L | +0.004 |
| Frac M | +0.682 |
| Frac N | -0.989 |
| Frac P | +0.065 |
| Frac Q | +0.095 |
| Frac R | +0.445 |
| Frac S | -0.551 |
| Frac T | +1.356 |
| Frac V | +0.838 |
| Frac W | -0.508 |
| Frac Y | -0.609 |
| Frac K+R | +0.658 |
| Frac D+E | +0.404 |
| Frac Polar | -0.003 |
| Frac Aliphatic | -0.962 |
| Frac Aromatic | -1.123 |
| R/K Ratio | -0.133 |
| E/D Ratio | -0.565 |
| Frac Chain Expanding | +0.904 |
| FCR | +0.735 |
| NCPR | +0.127 |
| Hydrophobicity | -1.101 |
| Disorder Promoting | +0.917 |
| Iso point | +0.401 |
| PPII | +0.346 |
| A Patch | -0.265 |
| C Patch | -0.009 |
| D Patch | -0.178 |
| E Patch | -0.349 |
| F Patch | -0.012 |
| G Patch | -0.259 |
| H Patch | -0.077 |
| I Patch | -0.011 |
| K Patch | -0.253 |
| L Patch | -0.096 |
| M Patch | -0.026 |
| N Patch | -0.076 |
| P Patch | -0.447 |
| Q Patch | -0.160 |
| R Patch | -0.247 |
| S Patch | -0.481 |
| T Patch | -0.147 |
| V Patch | -0.051 |
| Y Patch | -0.022 |
| RG Frac | -0.130 |